Icon representing a puzzle

2707: Revisiting Puzzle 67: Integrase

Closed since 2 months ago

Novice Overall Prediction

Summary

Created
December 31, 2025
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This DNA-binding domain is part of a bacterial integrase protein, which facilitates the insertion of new DNA into the bacterial chromosome. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
EKRRDNRGRILKTGESQRKDGRYLYKYIDSFGEPQFVYSWKLVATDRVPAGKRDCISLREKIAELQKDIHD

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,525
  2. Avatar for Go Science 2. Go Science 68 pts. 10,481
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 44 pts. 10,435
  4. Avatar for VeFold 4. VeFold 27 pts. 10,428
  5. Avatar for Australia 5. Australia 16 pts. 10,419
  6. Avatar for Contenders 6. Contenders 9 pts. 10,400
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 5 pts. 10,366
  8. Avatar for SETI.Germany 8. SETI.Germany 3 pts. 10,142
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,136
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,074
  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 9,911
  2. Avatar for hada 52. hada Lv 1 1 pt. 9,910
  3. Avatar for Trajan464 53. Trajan464 Lv 1 1 pt. 9,818
  4. Avatar for ShadowTactics 54. ShadowTactics Lv 1 1 pt. 9,791
  5. Avatar for Mohoernchen 55. Mohoernchen Lv 1 1 pt. 9,779
  6. Avatar for ProfVince 56. ProfVince Lv 1 1 pt. 9,757
  7. Avatar for Altercomp 57. Altercomp Lv 1 1 pt. 9,711
  8. Avatar for screenager 58. screenager Lv 1 1 pt. 9,694
  9. Avatar for frostschutz 59. frostschutz Lv 1 1 pt. 9,691
  10. Avatar for prkfour 60. prkfour Lv 1 1 pt. 9,680

Comments