Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 2 months ago

Novice Overall Prediction

Summary


Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 11,112
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 11,010
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 10,992
  4. Avatar for Serca 4. Serca Lv 1 82 pts. 10,954
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 76 pts. 10,938
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 71 pts. 10,909
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 66 pts. 10,898
  8. Avatar for akaaka 8. akaaka Lv 1 61 pts. 10,891
  9. Avatar for ichwilldiesennamen 9. ichwilldiesennamen Lv 1 56 pts. 10,870
  10. Avatar for grogar7 10. grogar7 Lv 1 52 pts. 10,808

Comments