Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 3 months ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction

Summary


Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 11,112
  2. Avatar for dcrwheeler 2. dcrwheeler Lv 1 94 pts. 11,010
  3. Avatar for LociOiling 3. LociOiling Lv 1 88 pts. 10,992
  4. Avatar for Serca 4. Serca Lv 1 82 pts. 10,954
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 76 pts. 10,938
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 71 pts. 10,909
  7. Avatar for SemperRabbit 7. SemperRabbit Lv 1 66 pts. 10,898
  8. Avatar for akaaka 8. akaaka Lv 1 61 pts. 10,891
  9. Avatar for ichwilldiesennamen 9. ichwilldiesennamen Lv 1 56 pts. 10,870
  10. Avatar for grogar7 10. grogar7 Lv 1 52 pts. 10,808

Comments