Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793
  1. Avatar for dpmattingly 21. dpmattingly Lv 1 21 pts. 10,640
  2. Avatar for Xendrais 22. Xendrais Lv 1 19 pts. 10,637
  3. Avatar for nicobul 23. nicobul Lv 1 17 pts. 10,610
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 16 pts. 10,610
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 14 pts. 10,596
  6. Avatar for Wanderer09 26. Wanderer09 Lv 1 13 pts. 10,576
  7. Avatar for westchuck 27. westchuck Lv 1 12 pts. 10,567
  8. Avatar for silent gene 28. silent gene Lv 1 10 pts. 10,559
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 9 pts. 10,536
  10. Avatar for devil_mantis 30. devil_mantis Lv 1 8 pts. 10,533

Comments