Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 4 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 10,384
  2. Avatar for Team China 12. Team China 1 pt. 9,793

  1. Avatar for justdumb 71. justdumb Lv 1 1 pt. 3,796
  2. Avatar for t0rtoise27 72. t0rtoise27 Lv 1 1 pt. 3,796
  3. Avatar for georg137 73. georg137 Lv 1 1 pt. 3,796
  4. Avatar for ZeroLeak7 74. ZeroLeak7 Lv 1 1 pt. 3,796

Comments