Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 4 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390

  1. Avatar for dpmattingly 21. dpmattingly Lv 1 21 pts. 10,640
  2. Avatar for Xendrais 22. Xendrais Lv 1 19 pts. 10,637
  3. Avatar for nicobul 23. nicobul Lv 1 17 pts. 10,610
  4. Avatar for NinjaGreg 24. NinjaGreg Lv 1 16 pts. 10,610
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 14 pts. 10,596
  6. Avatar for Wanderer09 26. Wanderer09 Lv 1 13 pts. 10,576
  7. Avatar for westchuck 27. westchuck Lv 1 12 pts. 10,567
  8. Avatar for silent gene 28. silent gene Lv 1 10 pts. 10,559
  9. Avatar for Anfinsen_slept_here 29. Anfinsen_slept_here Lv 1 9 pts. 10,536
  10. Avatar for devil_mantis 30. devil_mantis Lv 1 8 pts. 10,533

Comments