Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390
  1. Avatar for abiogenesis 41. abiogenesis Lv 1 2 pts. 10,370
  2. Avatar for Fasodankfds 42. Fasodankfds Lv 1 2 pts. 10,364
  3. Avatar for Tian00 43. Tian00 Lv 1 2 pts. 10,337
  4. Avatar for Vinara 44. Vinara Lv 1 2 pts. 10,336
  5. Avatar for jamestpierce 45. jamestpierce Lv 1 1 pt. 10,328
  6. Avatar for pfirth 46. pfirth Lv 1 1 pt. 10,303
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 10,268
  8. Avatar for Dr.Sillem 48. Dr.Sillem Lv 1 1 pt. 10,234
  9. Avatar for Larini 49. Larini Lv 1 1 pt. 10,201
  10. Avatar for ProfVince 50. ProfVince Lv 1 1 pt. 10,174

Comments