Icon representing a puzzle

2716: Revisiting Puzzle 70: Nucleosome Protein

Closed since 4 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
January 21, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,112
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 63 pts. 10,992
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 37 pts. 10,909
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 10,785
  5. Avatar for Australia 5. Australia 11 pts. 10,765
  6. Avatar for Contenders 6. Contenders 5 pts. 10,717
  7. Avatar for VeFold 7. VeFold 2 pts. 10,708
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,695
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 10,596
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 10,390
  1. Avatar for Idiotboy 71. Idiotboy Lv 1 1 pt. 3,796
  2. Avatar for ZeroLeak7 72. ZeroLeak7 Lv 1 1 pt. 3,796
  3. Avatar for t0rtoise27 73. t0rtoise27 Lv 1 1 pt. 3,796
  4. Avatar for georg137 74. georg137 Lv 1 1 pt. 3,796

Comments