Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 2 months ago

Novice Overall Prediction Electron Density

Summary

Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups

  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539
  1. Avatar for silent gene 21. silent gene Lv 1 19 pts. 25,624
  2. Avatar for BarrySampson 22. BarrySampson Lv 1 17 pts. 25,609
  3. Avatar for akaaka 23. akaaka Lv 1 16 pts. 25,607
  4. Avatar for AlkiP0Ps 24. AlkiP0Ps Lv 1 14 pts. 25,596
  5. Avatar for TheGUmmer 25. TheGUmmer Lv 1 13 pts. 25,571
  6. Avatar for Wanderer09 26. Wanderer09 Lv 1 11 pts. 25,562
  7. Avatar for Anfinsen_slept_here 27. Anfinsen_slept_here Lv 1 10 pts. 25,547
  8. Avatar for zxspectrum 28. zxspectrum Lv 1 9 pts. 25,538
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 8 pts. 25,537
  10. Avatar for jausmh 30. jausmh Lv 1 7 pts. 25,518

Comments