2720: Electron Density Reconstruction 155
Closed since about 2 months ago
Novice Overall Prediction Electron DensitySummary
- Created
- January 21, 2026
- Expires
- Max points
- 100
The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X
- Sequence
- MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS