Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary


Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539

  1. Avatar for NinjaGreg 31. NinjaGreg Lv 1 7 pts. 25,445
  2. Avatar for SemperRabbit 32. SemperRabbit Lv 1 6 pts. 25,432
  3. Avatar for manu8170 33. manu8170 Lv 1 5 pts. 25,358
  4. Avatar for ZeroLeak7 34. ZeroLeak7 Lv 1 5 pts. 25,339
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 4 pts. 25,326
  6. Avatar for Dr.Sillem 36. Dr.Sillem Lv 1 4 pts. 25,224
  7. Avatar for Joanna_H 37. Joanna_H Lv 1 3 pts. 25,213
  8. Avatar for stomjoh 38. stomjoh Lv 1 3 pts. 25,149
  9. Avatar for Trajan464 39. Trajan464 Lv 1 2 pts. 25,115
  10. Avatar for AlphaFold2 40. AlphaFold2 Lv 1 2 pts. 25,061

Comments