Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary


Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539

  1. Avatar for hada 41. hada Lv 1 2 pts. 24,945
  2. Avatar for pfirth 42. pfirth Lv 1 2 pts. 24,880
  3. Avatar for BURGS69 43. BURGS69 Lv 1 2 pts. 24,863
  4. Avatar for Tian00 44. Tian00 Lv 1 1 pt. 24,837
  5. Avatar for RichGuilmain 45. RichGuilmain Lv 1 1 pt. 24,808
  6. Avatar for abiogenesis 46. abiogenesis Lv 1 1 pt. 24,786
  7. Avatar for carxo 47. carxo Lv 1 1 pt. 24,756
  8. Avatar for ProfVince 48. ProfVince Lv 1 1 pt. 24,694
  9. Avatar for Larini 49. Larini Lv 1 1 pt. 24,690
  10. Avatar for Th1sN@me!sN0tAPun 50. Th1sN@me!sN0tAPun Lv 1 1 pt. 24,664

Comments