Placeholder image of a protein
Icon representing a puzzle

2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary


Created
January 21, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

Sequence
MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups


  1. Avatar for BIOTF345 11. BIOTF345 1 pt. 23,539

  1. Avatar for zbp 51. zbp Lv 1 1 pt. 24,659
  2. Avatar for Aarav_Awasthi 52. Aarav_Awasthi Lv 1 1 pt. 24,544
  3. Avatar for Zhang Ruichong 53. Zhang Ruichong Lv 1 1 pt. 24,543
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 1 pt. 24,487
  5. Avatar for Fasodankfds 55. Fasodankfds Lv 1 1 pt. 24,455
  6. Avatar for toshiue 56. toshiue Lv 1 1 pt. 24,343
  7. Avatar for drumpeter18yrs9yrs 57. drumpeter18yrs9yrs Lv 1 1 pt. 24,169
  8. Avatar for Negrilo 58. Negrilo Lv 1 1 pt. 24,145
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 23,848
  10. Avatar for Mohoernchen 60. Mohoernchen Lv 1 1 pt. 23,846

Comments