2720: Electron Density Reconstruction 155

Closed since about 1 month ago

Summary

• Created: January 21, 2026
• Expires: February 05, 2026 at 18:00 UTC
• Max points: 100

Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.This puzzle comes from PDB entry 2O9X

• Sequence: MGSSHHHHHHSSGRENLYFQGHMREHLKLFSLIFSYPDEDKLGKAIALAEGIGLTEIAQTLKQVDIEALQVEYTSLFISSHPSVPCPPYQSYFEEGSVYGKASLRAAELYSKYGLNYVYESEPPDHISVELEFLSMNPELLSDFRDWFLEFAKCVEEKSEIYATFARAFRKFLEKPSKVQS

Top groups

• 1. Go Science 100 pts. 25,923
• 2. L'Alliance Francophone 60 pts. 25,877
• 3. Anthropic Dreams 33 pts. 25,854
• 4. Contenders 17 pts. 25,851
• 5. VeFold 8 pts. 25,670
• 6. Australia 4 pts. 25,596
• 7. Void Crushers 2 pts. 25,571
• 8. FamilyBarmettler 1 pt. 25,537
• 9. Marvin's bunch 1 pt. 25,518
• 10. Gargleblasters 1 pt. 25,213

Top soloists

• 11. Bruno Kestemont 47 pts. 25,756
• 12. spvincent 43 pts. 25,706
• 13. g_b 40 pts. 25,699
• 14. gmn 36 pts. 25,685
• 15. nicobul 33 pts. 25,673
• 16. BootsMcGraw 30 pts. 25,670
• 17. Xendrais 28 pts. 25,670
• 18. westchuck 25 pts. 25,661
• 19. Elfi 23 pts. 25,643
• 20. dcrwheeler 21 pts. 25,641