Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since about 1 month ago

Novice Overall Prediction

Summary


Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 11,227
  2. Avatar for Go Science 2. Go Science 63 pts. 11,214
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 11,206
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 11,136
  5. Avatar for Australia 5. Australia 11 pts. 11,102
  6. Avatar for VeFold 6. VeFold 5 pts. 11,101
  7. Avatar for Contenders 7. Contenders 2 pts. 11,097
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,011
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,674
  10. Avatar for CBE_ProEn_2025 10. CBE_ProEn_2025 1 pt. 10,285

  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 54 pts. 11,160
  2. Avatar for westchuck 12. westchuck Lv 1 51 pts. 11,158
  3. Avatar for Galaxie 13. Galaxie Lv 1 48 pts. 11,145
  4. Avatar for Apothecary1815 14. Apothecary1815 Lv 1 45 pts. 11,141
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 42 pts. 11,136
  6. Avatar for Dr. Goochie 16. Dr. Goochie Lv 1 39 pts. 11,120
  7. Avatar for Bruno Kestemont 17. Bruno Kestemont Lv 1 36 pts. 11,108
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 34 pts. 11,102
  9. Avatar for nicobul 19. nicobul Lv 1 31 pts. 11,102
  10. Avatar for Xendrais 20. Xendrais Lv 1 29 pts. 11,101

Comments