Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 11,227
  2. Avatar for Go Science 2. Go Science 63 pts. 11,214
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 11,206
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 11,136
  5. Avatar for Australia 5. Australia 11 pts. 11,102
  6. Avatar for VeFold 6. VeFold 5 pts. 11,101
  7. Avatar for Contenders 7. Contenders 2 pts. 11,097
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,011
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,674
  10. Avatar for CBE_ProEn_2025 10. CBE_ProEn_2025 1 pt. 10,285
  1. Avatar for Wanderer09 41. Wanderer09 Lv 1 5 pts. 10,620
  2. Avatar for ProfVince 42. ProfVince Lv 1 4 pts. 10,593
  3. Avatar for SemperRabbit 43. SemperRabbit Lv 1 4 pts. 10,565
  4. Avatar for firejuggler 44. firejuggler Lv 1 4 pts. 10,499
  5. Avatar for Alistair69 45. Alistair69 Lv 1 3 pts. 10,490
  6. Avatar for Larini 46. Larini Lv 1 3 pts. 10,428
  7. Avatar for Altercomp 47. Altercomp Lv 1 3 pts. 10,381
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 2 pts. 10,377
  9. Avatar for Th1sN@me!sN0tAPun 49. Th1sN@me!sN0tAPun Lv 1 2 pts. 10,346
  10. Avatar for rovergaard 50. rovergaard Lv 1 2 pts. 10,285

Comments