Icon representing a puzzle

2719: Revisiting Puzzle 71: Crystallin

Closed since about 1 month ago

Novice Overall Prediction

Summary

Created
January 28, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 11,227
  2. Avatar for Go Science 2. Go Science 63 pts. 11,214
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 37 pts. 11,206
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 21 pts. 11,136
  5. Avatar for Australia 5. Australia 11 pts. 11,102
  6. Avatar for VeFold 6. VeFold 5 pts. 11,101
  7. Avatar for Contenders 7. Contenders 2 pts. 11,097
  8. Avatar for Void Crushers 8. Void Crushers 1 pt. 11,011
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,674
  10. Avatar for CBE_ProEn_2025 10. CBE_ProEn_2025 1 pt. 10,285
  1. Avatar for D135 71. D135 Lv 1 1 pt. 9,747
  2. Avatar for sumi.10 72. sumi.10 Lv 1 1 pt. 9,739
  3. Avatar for mxduh 73. mxduh Lv 1 1 pt. 9,735
  4. Avatar for lnsywhj 74. lnsywhj Lv 1 1 pt. 9,708
  5. Avatar for debraj ghosh 75. debraj ghosh Lv 1 1 pt. 9,698
  6. Avatar for RWoodcock 76. RWoodcock Lv 1 1 pt. 9,631
  7. Avatar for kanishk_1210 77. kanishk_1210 Lv 1 1 pt. 9,555
  8. Avatar for amritha 78. amritha Lv 1 1 pt. 9,543
  9. Avatar for Lakshay Bansal 79. Lakshay Bansal Lv 1 1 pt. 9,365
  10. Avatar for Tej Pratap 80. Tej Pratap Lv 1 1 pt. 9,301

Comments