Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since about 2 months ago

Novice Overall Prediction Electron Density

Summary


Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226

  1. Avatar for christioanchauvin 100 pts. 39,454
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 93 pts. 39,453
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 86 pts. 39,420
  4. Avatar for LociOiling 4. LociOiling Lv 1 79 pts. 39,344
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 73 pts. 39,290
  6. Avatar for drjr 6. drjr Lv 1 67 pts. 39,278
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 62 pts. 39,233
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 57 pts. 39,233
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 52 pts. 39,229
  10. Avatar for Galaxie 10. Galaxie Lv 1 47 pts. 39,226

Comments