Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 39,454
  2. Avatar for Go Science 2. Go Science 63 pts. 39,453
  3. Avatar for Contenders 3. Contenders 37 pts. 39,449
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 39,365
  5. Avatar for VeFold 5. VeFold 11 pts. 39,219
  6. Avatar for Australia 6. Australia 5 pts. 39,196
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 38,837
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 38,360
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 38,160
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 37,901

  1. Avatar for christioanchauvin 100 pts. 39,454
  2. Avatar for bravosk8erboy 2. bravosk8erboy Lv 1 93 pts. 39,453
  3. Avatar for Bletchley Park 3. Bletchley Park Lv 1 86 pts. 39,420
  4. Avatar for LociOiling 4. LociOiling Lv 1 79 pts. 39,344
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 73 pts. 39,290
  6. Avatar for drjr 6. drjr Lv 1 67 pts. 39,278
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 62 pts. 39,233
  8. Avatar for ichwilldiesennamen 8. ichwilldiesennamen Lv 1 57 pts. 39,233
  9. Avatar for dcrwheeler 9. dcrwheeler Lv 1 52 pts. 39,229
  10. Avatar for Galaxie 10. Galaxie Lv 1 47 pts. 39,226

Comments