Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since 27 days ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226
  1. Avatar for Elfi 11. Elfi Lv 1 43 pts. 39,219
  2. Avatar for Xendrais 12. Xendrais Lv 1 39 pts. 39,212
  3. Avatar for AlkiP0Ps 13. AlkiP0Ps Lv 1 36 pts. 39,196
  4. Avatar for spvincent 14. spvincent Lv 1 33 pts. 39,159
  5. Avatar for grogar7 15. grogar7 Lv 1 30 pts. 39,133
  6. Avatar for g_b 16. g_b Lv 1 27 pts. 39,063
  7. Avatar for dpmattingly 17. dpmattingly Lv 1 24 pts. 39,018
  8. Avatar for silent gene 18. silent gene Lv 1 22 pts. 38,997
  9. Avatar for nicobul 19. nicobul Lv 1 20 pts. 38,923
  10. Avatar for BootsMcGraw 20. BootsMcGraw Lv 1 18 pts. 38,890

Comments