Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226

  1. Avatar for akaaka 21. akaaka Lv 1 16 pts. 38,882
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 14 pts. 38,837
  3. Avatar for westchuck 23. westchuck Lv 1 13 pts. 38,794
  4. Avatar for Wanderer09 24. Wanderer09 Lv 1 11 pts. 38,736
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 10 pts. 38,554
  6. Avatar for gmn 26. gmn Lv 1 9 pts. 38,420
  7. Avatar for jausmh 27. jausmh Lv 1 8 pts. 38,360
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 7 pts. 38,349
  9. Avatar for TheGUmmer 29. TheGUmmer Lv 1 6 pts. 38,160
  10. Avatar for zxspectrum 30. zxspectrum Lv 1 5 pts. 38,142

Comments