Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary


Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226

  1. Avatar for hada 41. hada Lv 1 1 pt. 37,279
  2. Avatar for Fasodankfds 42. Fasodankfds Lv 1 1 pt. 37,185
  3. Avatar for Vinara 43. Vinara Lv 1 1 pt. 37,143
  4. Avatar for carxo 44. carxo Lv 1 1 pt. 36,997
  5. Avatar for abiogenesis 45. abiogenesis Lv 1 1 pt. 36,819
  6. Avatar for Larini 46. Larini Lv 1 1 pt. 36,697
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 1 pt. 36,346
  8. Avatar for Wildice1100 48. Wildice1100 Lv 1 1 pt. 36,266
  9. Avatar for pfirth 49. pfirth Lv 1 1 pt. 36,091
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 1 pt. 35,918

Comments