Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since 26 days ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226
  1. Avatar for zbp 51. zbp Lv 1 1 pt. 35,845
  2. Avatar for drumpeter18yrs9yrs 52. drumpeter18yrs9yrs Lv 1 1 pt. 35,759
  3. Avatar for RWoodcock 53. RWoodcock Lv 1 1 pt. 35,495
  4. Avatar for Mohoernchen 54. Mohoernchen Lv 1 1 pt. 35,445
  5. Avatar for Savas 55. Savas Lv 1 1 pt. 35,226
  6. Avatar for Stas Gunko 56. Stas Gunko Lv 1 1 pt. 35,060
  7. Avatar for rinze 57. rinze Lv 1 1 pt. 35,042
  8. Avatar for DScott 58. DScott Lv 1 1 pt. 34,941
  9. Avatar for gmeleos 59. gmeleos Lv 1 1 pt. 34,883
  10. Avatar for Swapper242 60. Swapper242 Lv 1 1 pt. 34,848

Comments