Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since about 1 month ago

Novice Overall Prediction Electron Density

Summary

Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 37,389
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 35,226
  1. Avatar for efull 61. efull Lv 1 1 pt. 34,805
  2. Avatar for p.naka 62. p.naka Lv 1 1 pt. 32,835
  3. Avatar for horowsah 63. horowsah Lv 1 1 pt. 21,193
  4. Avatar for Connor_Lawrence 64. Connor_Lawrence Lv 1 1 pt. 9,802
  5. Avatar for Serca 65. Serca Lv 1 1 pt. 9,802

Comments