Placeholder image of a protein
Icon representing a puzzle

2726: Electron Density Reconstruction 157

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
February 05, 2026
Expires
Max points
100
Description

The structure of this protein complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2OE2.

Sequence
MAQQAPDREKALELAMAQIDKNFGKGSVMRLGEEVRQPISVIPTGSISLDVALGIGGLPRGRVIEIYGPESSGKTTVALHAVANAQAAGGIAAFIDAEHALDPEYAKKLGVDTDSLLVSQPDTGEQALEIADMLVRSGALDIIVIDSVAALVPRAEIEGEMGDSHVGLQARLMSQALRKMTGALNNSGTTAIFINQLREKIGVMFGSPETTTGGKALKFYASVRLDVRRIETLKDGTDAVGNRTRVKVVKNKVSPPFKQAEFDILYGQGISREGSLIDMGVEHGFIRKSGSWFTYEGEQLGQGKENARKFLLENTDVANEIEKKIKEKLGIGAVVTAEADDVLPAPVDF

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 39,454
  2. Avatar for Go Science 2. Go Science 63 pts. 39,453
  3. Avatar for Contenders 3. Contenders 37 pts. 39,449
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 21 pts. 39,365
  5. Avatar for VeFold 5. VeFold 11 pts. 39,219
  6. Avatar for Australia 6. Australia 5 pts. 39,196
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 2 pts. 38,837
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 38,360
  9. Avatar for Void Crushers 9. Void Crushers 1 pt. 38,160
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 37,901

  1. Avatar for NinjaGreg 31. NinjaGreg Lv 1 5 pts. 37,955
  2. Avatar for Pazithi 32. Pazithi Lv 1 4 pts. 37,901
  3. Avatar for Trajan464 33. Trajan464 Lv 1 4 pts. 37,801
  4. Avatar for stomjoh 34. stomjoh Lv 1 3 pts. 37,710
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 3 pts. 37,637
  6. Avatar for toshiue 36. toshiue Lv 1 2 pts. 37,567
  7. Avatar for AlphaFold2 37. AlphaFold2 Lv 1 2 pts. 37,554
  8. Avatar for vybi 38. vybi Lv 1 2 pts. 37,496
  9. Avatar for kitek314_pl 39. kitek314_pl Lv 1 2 pts. 37,389
  10. Avatar for Crossed Sticks 40. Crossed Sticks Lv 1 1 pt. 37,285

Comments