Icon representing a puzzle

2728: Revisiting Puzzle 74: Platypus Venom

Closed since 17 days ago

Novice Overall Prediction

Summary

Created
February 18, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 8,626
  1. Avatar for kitek314_pl 41. kitek314_pl Lv 1 1 pt. 8,684
  2. Avatar for Th1sN@me!sN0tAPun 42. Th1sN@me!sN0tAPun Lv 1 1 pt. 8,651
  3. Avatar for Savas 43. Savas Lv 1 1 pt. 8,626
  4. Avatar for Wildice1100 44. Wildice1100 Lv 1 1 pt. 8,607
  5. Avatar for Dr.Sillem 45. Dr.Sillem Lv 1 1 pt. 8,603
  6. Avatar for RWoodcock 46. RWoodcock Lv 1 1 pt. 8,579
  7. Avatar for pizpot 47. pizpot Lv 1 1 pt. 8,523
  8. Avatar for carxo 48. carxo Lv 1 1 pt. 8,517
  9. Avatar for hada 49. hada Lv 1 1 pt. 8,455
  10. Avatar for Stas Gunko 50. Stas Gunko Lv 1 1 pt. 8,455

Comments