Icon representing a puzzle

2731: Revisiting Puzzle 75: Antifreeze Protein

Closed since 13 days ago

Novice Overall Prediction

Summary

Created
February 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 9,725
  1. Avatar for LAPUZZAANDREA 51. LAPUZZAANDREA Lv 1 1 pt. 9,466
  2. Avatar for Mohoernchen 52. Mohoernchen Lv 1 1 pt. 9,362
  3. Avatar for Apothecary1815 53. Apothecary1815 Lv 1 1 pt. 9,310
  4. Avatar for rinze 54. rinze Lv 1 1 pt. 9,306
  5. Avatar for visyix 55. visyix Lv 1 1 pt. 9,291
  6. Avatar for Jimmalas 56. Jimmalas Lv 1 1 pt. 9,286
  7. Avatar for mart0258 57. mart0258 Lv 1 1 pt. 9,283
  8. Avatar for neilsebas 58. neilsebas Lv 1 1 pt. 9,273
  9. Avatar for Painture 59. Painture Lv 1 1 pt. 9,273
  10. Avatar for gmeleos 60. gmeleos Lv 1 1 pt. 9,267

Comments