Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 18,862
  2. Avatar for Team China 12. Team China 1 pt. 18,549
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 18,231
  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 34,750
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 34,750
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 86 pts. 34,725
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 79 pts. 34,719
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 73 pts. 34,712
  6. Avatar for Galaxie 6. Galaxie Lv 1 68 pts. 34,701
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 62 pts. 34,690
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 57 pts. 34,665
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 52 pts. 34,647
  10. Avatar for grogar7 10. grogar7 Lv 1 48 pts. 34,644

Comments