Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 3 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups


  1. Avatar for Go Science 100 pts. 34,777
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 34,766
  3. Avatar for Contenders 3. Contenders 41 pts. 34,750
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 34,719
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 34,665
  6. Avatar for Australia 6. Australia 7 pts. 34,647
  7. Avatar for VeFold 7. VeFold 4 pts. 34,574
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 31,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 26,446
  10. Avatar for Street Smarts 10. Street Smarts 1 pt. 21,368

  1. Avatar for Bletchley Park
    1. Bletchley Park Lv 1
    100 pts. 34,750
  2. Avatar for LociOiling 2. LociOiling Lv 1 93 pts. 34,750
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 86 pts. 34,725
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 79 pts. 34,719
  5. Avatar for Dr. Goochie 5. Dr. Goochie Lv 1 73 pts. 34,712
  6. Avatar for Galaxie 6. Galaxie Lv 1 68 pts. 34,701
  7. Avatar for bravosk8erboy 7. bravosk8erboy Lv 1 62 pts. 34,690
  8. Avatar for WBarme1234 8. WBarme1234 Lv 1 57 pts. 34,665
  9. Avatar for AlkiP0Ps 9. AlkiP0Ps Lv 1 52 pts. 34,647
  10. Avatar for grogar7 10. grogar7 Lv 1 48 pts. 34,644

Comments