Placeholder image of a protein
Icon representing a puzzle

2738: Electron Density Reconstruction 161

Closed since 16 days ago

Novice Overall Prediction Electron Density

Summary

Created
March 03, 2026
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2R5Z

Sequence
ACTCTAAGATTAATCGGCTG GKKNPPQIYPWMKRVHLGTSTVNANGETKRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK ARRKRRNFSKQASEILNEYFYSHLSNPYPSEEAKEELARKCGITVSQVSNWFGNKRIRYKKNI TCAGCCGATTAATCTTAGAG

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 34,777
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 65 pts. 34,766
  3. Avatar for Contenders 3. Contenders 41 pts. 34,750
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 24 pts. 34,719
  5. Avatar for FamilyBarmettler 5. FamilyBarmettler 14 pts. 34,665
  6. Avatar for Australia 6. Australia 7 pts. 34,647
  7. Avatar for VeFold 7. VeFold 4 pts. 34,574
  8. Avatar for Void Crushers 8. Void Crushers 2 pts. 31,061
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 26,446
  10. Avatar for Street Smarts 10. Street Smarts 1 pt. 21,368
  1. Avatar for TheGUmmer 31. TheGUmmer Lv 1 5 pts. 31,061
  2. Avatar for manu8170 32. manu8170 Lv 1 4 pts. 31,018
  3. Avatar for Schiff ahoi! 33. Schiff ahoi! Lv 1 4 pts. 28,800
  4. Avatar for dpmattingly 34. dpmattingly Lv 1 3 pts. 28,183
  5. Avatar for jausmh 35. jausmh Lv 1 3 pts. 26,446
  6. Avatar for NinjaGreg 36. NinjaGreg Lv 1 3 pts. 25,955
  7. Avatar for rinze 37. rinze Lv 1 2 pts. 25,577
  8. Avatar for gmn 38. gmn Lv 1 2 pts. 23,869
  9. Avatar for Egor Gunko 39. Egor Gunko Lv 1 2 pts. 23,798
  10. Avatar for Mohoernchen 40. Mohoernchen Lv 1 2 pts. 23,680

Comments