Placeholder image of a protein
Icon representing a puzzle

2747: Electron Density Reconstruction 164

Closed since about 2 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 24, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2VAF. It's a bit big, so trim tool is recommended.

Sequence
GLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 38,095
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 37,709
  3. Avatar for Contenders 3. Contenders 19 pts. 36,955
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 7 pts. 36,555
  5. Avatar for Go Science 5. Go Science 2 pts. 36,226
  6. Avatar for VeFold 6. VeFold 1 pt. 35,869
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 32,830
  8. Avatar for Australia 8. Australia 1 pt. 32,769

  1. Avatar for gmn 21. gmn Lv 1 4 pts. 32,693
  2. Avatar for zbp 22. zbp Lv 1 3 pts. 32,430
  3. Avatar for silent gene 23. silent gene Lv 1 2 pts. 32,252
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 2 pts. 32,110
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 2 pts. 32,078
  6. Avatar for toshiue 26. toshiue Lv 1 1 pt. 31,750
  7. Avatar for zxspectrum 27. zxspectrum Lv 1 1 pt. 31,616
  8. Avatar for Fasodankfds 28. Fasodankfds Lv 1 1 pt. 31,594
  9. Avatar for abiogenesis 29. abiogenesis Lv 1 1 pt. 31,583
  10. Avatar for Dr.Sillem 30. Dr.Sillem Lv 1 1 pt. 31,030

Comments