Placeholder image of a protein
Icon representing a puzzle

2747: Electron Density Reconstruction 164

Closed since about 2 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
March 24, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2VAF. It's a bit big, so trim tool is recommended.

Sequence
GLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Top groups


  1. Avatar for L'Alliance Francophone 100 pts. 38,095
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 37,709
  3. Avatar for Contenders 3. Contenders 19 pts. 36,955
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 7 pts. 36,555
  5. Avatar for Go Science 5. Go Science 2 pts. 36,226
  6. Avatar for VeFold 6. VeFold 1 pt. 35,869
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 32,830
  8. Avatar for Australia 8. Australia 1 pt. 32,769

  1. Avatar for christioanchauvin 100 pts. 38,095
  2. Avatar for Galaxie 2. Galaxie Lv 1 89 pts. 37,709
  3. Avatar for nicobul 3. nicobul Lv 1 78 pts. 37,582
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 68 pts. 36,955
  5. Avatar for WBarme1234 5. WBarme1234 Lv 1 60 pts. 36,555
  6. Avatar for akaaka 6. akaaka Lv 1 52 pts. 36,325
  7. Avatar for ichwilldiesennamen 7. ichwilldiesennamen Lv 1 45 pts. 36,226
  8. Avatar for Xendrais 8. Xendrais Lv 1 39 pts. 35,869
  9. Avatar for LociOiling 9. LociOiling Lv 1 33 pts. 35,655
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 28 pts. 35,576

Comments