Placeholder image of a protein
Icon representing a puzzle

2747: Electron Density Reconstruction 164

Closed since 15 days ago

Novice Novice Novice Overall Overall Overall Prediction Prediction Prediction Electron Density Electron Density Electron Density

Summary

Created
March 24, 2026
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. This puzzle comes from PDB entry 2VAF. It's a bit big, so trim tool is recommended.

Sequence
GLNFPTYDGKDRVVSLSEKNFKQVLKKYDLLCLYYHEPVSSDKVTQKQFQLKEIVLELVAQVLEHKAIGFVMVDAKKEAKLAKKLGFDEEGSLYILKGDRTIEFDGEFAADVLVEFLLDLIEDPVEIISSKLEVQAFERIEDYIKLIGFFKSEDSEYYKAFEEAAEHFQPYIKFFATFDKGVAKKLSLKMNEVDFYEPFMDEPIAIPNKPYTEEELVEFVKEHQRPTLRRLRPEEMFETWEDDLNGIHIVAFAEKSDPDGYEFLEILKQVARDNTDNPDLSILWIDPDDFPLLVAYWEKTFKIDLFRPQIGVVNVTDADSVWMEIPDDDDLPTAEELEDWIEDVLSGKINTEDDDEDDDDDDNSDEEDNDDSDDDDDE

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 38,095
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 47 pts. 37,709
  3. Avatar for Contenders 3. Contenders 19 pts. 36,955
  4. Avatar for FamilyBarmettler 4. FamilyBarmettler 7 pts. 36,555
  5. Avatar for Go Science 5. Go Science 2 pts. 36,226
  6. Avatar for VeFold 6. VeFold 1 pt. 35,869
  7. Avatar for Marvin's bunch 7. Marvin's bunch 1 pt. 32,830
  8. Avatar for Australia 8. Australia 1 pt. 32,769
  1. Avatar for spvincent 41. spvincent Lv 1 1 pt. 0

Comments