Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 9 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,863
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,750
  3. Avatar for fold me 13. fold me 1 pt. 7,527
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,356
  2. Avatar for Serca 2. Serca Lv 1 94 pts. 10,318
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 87 pts. 10,289
  4. Avatar for NinjaGreg 4. NinjaGreg Lv 1 81 pts. 10,272
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 75 pts. 10,263
  6. Avatar for Wanderer09 6. Wanderer09 Lv 1 70 pts. 10,215
  7. Avatar for Xendrais 7. Xendrais Lv 1 65 pts. 10,147
  8. Avatar for g_b 8. g_b Lv 1 60 pts. 10,136
  9. Avatar for grogar7 9. grogar7 Lv 1 56 pts. 10,103
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 51 pts. 10,088

Comments