Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Open for the next about 9 hours

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    10,340
  2. Avatar for Go Science 2. Go Science 10,273
  3. Avatar for Australia 3. Australia 10,059
  4. Avatar for VeFold 4. VeFold 10,050
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 9,987
  6. Avatar for Void Crushers 6. Void Crushers 9,974
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 9,886
  8. Avatar for Contenders 8. Contenders 9,685
  9. Avatar for Marvin's bunch 9. Marvin's bunch 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 8,791
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    10,340
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 10,273
  3. Avatar for NinjaGreg 3. NinjaGreg Lv 1 10,263
  4. Avatar for Serca 4. Serca Lv 1 10,233
  5. Avatar for AlkiP0Ps 5. AlkiP0Ps Lv 1 10,059
  6. Avatar for Xendrais 6. Xendrais Lv 1 10,050
  7. Avatar for Guiguitare 7. Guiguitare Lv 1 9,988
  8. Avatar for nicobul 8. nicobul Lv 1 9,987
  9. Avatar for TheGUmmer 9. TheGUmmer Lv 1 9,974
  10. Avatar for akaaka 10. akaaka Lv 1 9,967

Comments