Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 10 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,863
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,750
  3. Avatar for fold me 13. fold me 1 pt. 7,527
  1. Avatar for BarrySampson 31. BarrySampson Lv 1 7 pts. 9,700
  2. Avatar for Apothecary1815 32. Apothecary1815 Lv 1 6 pts. 9,694
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 6 pts. 9,691
  4. Avatar for devil_mantis 34. devil_mantis Lv 1 5 pts. 9,622
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,515
  6. Avatar for pfirth 36. pfirth Lv 1 4 pts. 9,452
  7. Avatar for lconor 37. lconor Lv 1 3 pts. 9,370
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 3 pts. 9,213
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 3 pts. 9,190
  10. Avatar for Fasodankfds 40. Fasodankfds Lv 1 2 pts. 9,141

Comments