Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 7 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for GENE 433 11. GENE 433 1 pt. 8,863
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,750
  3. Avatar for fold me 13. fold me 1 pt. 7,527
  1. Avatar for carxo 51. carxo Lv 1 1 pt. 8,762
  2. Avatar for ShadowTactics 52. ShadowTactics Lv 1 1 pt. 8,750
  3. Avatar for abiogenesis 53. abiogenesis Lv 1 1 pt. 8,741
  4. Avatar for DScott 54. DScott Lv 1 1 pt. 8,673
  5. Avatar for awa14 55. awa14 Lv 1 1 pt. 8,605
  6. Avatar for Trajan464 56. Trajan464 Lv 1 1 pt. 8,538
  7. Avatar for mengzach 57. mengzach Lv 1 1 pt. 8,507
  8. Avatar for p.naka 58. p.naka Lv 1 1 pt. 8,433
  9. Avatar for RWoodcock 59. RWoodcock Lv 1 1 pt. 8,231
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 8,144

Comments