Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 9 days ago

Novice Overall Prediction

Summary


Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,356
  2. Avatar for Go Science 2. Go Science 65 pts. 10,318
  3. Avatar for VeFold 3. VeFold 41 pts. 10,147
  4. Avatar for Australia 4. Australia 24 pts. 10,075
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,035
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,010
  7. Avatar for Contenders 7. Contenders 4 pts. 9,956
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 9,892
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,871

  1. Avatar for zxspectrum 21. zxspectrum Lv 1 20 pts. 9,924
  2. Avatar for christioanchauvin 22. christioanchauvin Lv 1 18 pts. 9,904
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 16 pts. 9,899
  4. Avatar for WBarme1234 24. WBarme1234 Lv 1 15 pts. 9,892
  5. Avatar for BootsMcGraw 25. BootsMcGraw Lv 1 13 pts. 9,878
  6. Avatar for roarshock 26. roarshock Lv 1 12 pts. 9,862
  7. Avatar for Tehnologik1 27. Tehnologik1 Lv 1 11 pts. 9,845
  8. Avatar for Bletchley Park 28. Bletchley Park Lv 1 10 pts. 9,830
  9. Avatar for silent gene 29. silent gene Lv 1 9 pts. 9,824
  10. Avatar for gmn 30. gmn Lv 1 8 pts. 9,777

Comments