Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 9 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,356
  2. Avatar for Go Science 2. Go Science 65 pts. 10,318
  3. Avatar for VeFold 3. VeFold 41 pts. 10,147
  4. Avatar for Australia 4. Australia 24 pts. 10,075
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,035
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,010
  7. Avatar for Contenders 7. Contenders 4 pts. 9,956
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 9,892
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,871
  1. Avatar for BarrySampson 31. BarrySampson Lv 1 7 pts. 9,700
  2. Avatar for Apothecary1815 32. Apothecary1815 Lv 1 6 pts. 9,694
  3. Avatar for Anfinsen_slept_here 33. Anfinsen_slept_here Lv 1 6 pts. 9,691
  4. Avatar for devil_mantis 34. devil_mantis Lv 1 5 pts. 9,622
  5. Avatar for heather-1 35. heather-1 Lv 1 4 pts. 9,515
  6. Avatar for pfirth 36. pfirth Lv 1 4 pts. 9,452
  7. Avatar for lconor 37. lconor Lv 1 3 pts. 9,370
  8. Avatar for Dr.Sillem 38. Dr.Sillem Lv 1 3 pts. 9,213
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 3 pts. 9,190
  10. Avatar for Fasodankfds 40. Fasodankfds Lv 1 2 pts. 9,141

Comments