Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 9 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,356
  2. Avatar for Go Science 2. Go Science 65 pts. 10,318
  3. Avatar for VeFold 3. VeFold 41 pts. 10,147
  4. Avatar for Australia 4. Australia 24 pts. 10,075
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,035
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,010
  7. Avatar for Contenders 7. Contenders 4 pts. 9,956
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 9,892
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,871
  1. Avatar for LHOr 41. LHOr Lv 1 2 pts. 9,131
  2. Avatar for hada 42. hada Lv 1 2 pts. 9,042
  3. Avatar for westchuck 43. westchuck Lv 1 2 pts. 9,010
  4. Avatar for Mohoernchen 44. Mohoernchen Lv 1 1 pt. 9,009
  5. Avatar for SWR_DMaster 45. SWR_DMaster Lv 1 1 pt. 9,001
  6. Avatar for ZiiONIC 46. ZiiONIC Lv 1 1 pt. 8,974
  7. Avatar for Larini 47. Larini Lv 1 1 pt. 8,918
  8. Avatar for zbp 48. zbp Lv 1 1 pt. 8,910
  9. Avatar for Savas 49. Savas Lv 1 1 pt. 8,871
  10. Avatar for Cagdason 50. Cagdason Lv 1 1 pt. 8,863

Comments