Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 9 days ago

Novice Overall Prediction

Summary

Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,356
  2. Avatar for Go Science 2. Go Science 65 pts. 10,318
  3. Avatar for VeFold 3. VeFold 41 pts. 10,147
  4. Avatar for Australia 4. Australia 24 pts. 10,075
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,035
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,010
  7. Avatar for Contenders 7. Contenders 4 pts. 9,956
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 9,892
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,871
  1. Avatar for efull 61. efull Lv 1 1 pt. 7,920
  2. Avatar for cnewm79 62. cnewm79 Lv 1 1 pt. 7,880
  3. Avatar for Painture 63. Painture Lv 1 1 pt. 7,838
  4. Avatar for Jimmalas 64. Jimmalas Lv 1 1 pt. 7,828
  5. Avatar for Stas Gunko 65. Stas Gunko Lv 1 1 pt. 7,804
  6. Avatar for junzhe1135 66. junzhe1135 Lv 1 1 pt. 7,527
  7. Avatar for Dr.bleue 67. Dr.bleue Lv 1 1 pt. 7,283
  8. Avatar for peperonnie900 68. peperonnie900 Lv 1 1 pt. 7,271
  9. Avatar for brucederby 69. brucederby Lv 1 1 pt. 7,003
  10. Avatar for kellykong 70. kellykong Lv 1 1 pt. 5,388

Comments