Icon representing a puzzle

2743: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since 2 months ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 25, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,356
  2. Avatar for Go Science 2. Go Science 65 pts. 10,318
  3. Avatar for VeFold 3. VeFold 41 pts. 10,147
  4. Avatar for Australia 4. Australia 24 pts. 10,075
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 10,035
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 7 pts. 10,010
  7. Avatar for Contenders 7. Contenders 4 pts. 9,956
  8. Avatar for FamilyBarmettler 8. FamilyBarmettler 2 pts. 9,892
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 9,370
  10. Avatar for Eὕρηκα! Heureka! 10. Eὕρηκα! Heureka! 1 pt. 8,871

  1. Avatar for Idiotboy 11. Idiotboy Lv 1 47 pts. 10,078
  2. Avatar for AlkiP0Ps 12. AlkiP0Ps Lv 1 44 pts. 10,075
  3. Avatar for Dr. Goochie 13. Dr. Goochie Lv 1 40 pts. 10,061
  4. Avatar for TheGUmmer 14. TheGUmmer Lv 1 37 pts. 10,035
  5. Avatar for nicobul 15. nicobul Lv 1 34 pts. 10,010
  6. Avatar for Galaxie 16. Galaxie Lv 1 31 pts. 10,003
  7. Avatar for Guiguitare 17. Guiguitare Lv 1 28 pts. 9,988
  8. Avatar for Elfi 18. Elfi Lv 1 26 pts. 9,979
  9. Avatar for akaaka 19. akaaka Lv 1 24 pts. 9,967
  10. Avatar for actiasluna 20. actiasluna Lv 1 22 pts. 9,956

Comments