Icon representing a puzzle

2746: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 24 hours ago

Novice Overall Prediction

Summary


Created
April 01, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,931
  2. Avatar for Go Science 2. Go Science 52 pts. 10,824
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,572
  4. Avatar for VeFold 4. VeFold 10 pts. 10,559
  5. Avatar for Contenders 5. Contenders 4 pts. 10,533
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 1 pt. 10,430
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 10,385
  8. Avatar for GENE 433 8. GENE 433 1 pt. 9,985
  9. Avatar for Australia 9. Australia 1 pt. 9,970

  1. Avatar for actiasluna 11. actiasluna Lv 1 28 pts. 10,415
  2. Avatar for Elfi 12. Elfi Lv 1 24 pts. 10,411
  3. Avatar for akaaka 13. akaaka Lv 1 21 pts. 10,404
  4. Avatar for nicobul 14. nicobul Lv 1 18 pts. 10,392
  5. Avatar for WBarme1234 15. WBarme1234 Lv 1 15 pts. 10,385
  6. Avatar for roarshock 16. roarshock Lv 1 13 pts. 10,295
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 11 pts. 10,260
  8. Avatar for Fasodankfds 18. Fasodankfds Lv 1 9 pts. 10,229
  9. Avatar for Guiguitare 19. Guiguitare Lv 1 8 pts. 10,217
  10. Avatar for g_b 20. g_b Lv 1 6 pts. 10,208

Comments