Icon representing a puzzle

2746: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 24 hours ago

Novice Overall Prediction

Summary

Created
April 01, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,931
  2. Avatar for Go Science 2. Go Science 52 pts. 10,824
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,572
  4. Avatar for VeFold 4. VeFold 10 pts. 10,559
  5. Avatar for Contenders 5. Contenders 4 pts. 10,533
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 1 pt. 10,430
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 10,385
  8. Avatar for GENE 433 8. GENE 433 1 pt. 9,985
  9. Avatar for Australia 9. Australia 1 pt. 9,970
  1. Avatar for Galaxie 21. Galaxie Lv 1 5 pts. 10,207
  2. Avatar for zbp 22. zbp Lv 1 4 pts. 10,190
  3. Avatar for silent gene 23. silent gene Lv 1 4 pts. 10,185
  4. Avatar for hada 24. hada Lv 1 3 pts. 10,169
  5. Avatar for Dr.Sillem 25. Dr.Sillem Lv 1 2 pts. 10,147
  6. Avatar for Anfinsen_slept_here 26. Anfinsen_slept_here Lv 1 2 pts. 10,117
  7. Avatar for Apothecary1815 27. Apothecary1815 Lv 1 2 pts. 10,082
  8. Avatar for SWR_DMaster 28. SWR_DMaster Lv 1 1 pt. 10,056
  9. Avatar for abiogenesis 29. abiogenesis Lv 1 1 pt. 10,052
  10. Avatar for BarrySampson 30. BarrySampson Lv 1 1 pt. 10,018

Comments