Icon representing a puzzle

2746: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since about 24 hours ago

Novice Overall Prediction

Summary

Created
April 01, 2026
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,931
  2. Avatar for Go Science 2. Go Science 52 pts. 10,824
  3. Avatar for Void Crushers 3. Void Crushers 24 pts. 10,572
  4. Avatar for VeFold 4. VeFold 10 pts. 10,559
  5. Avatar for Contenders 5. Contenders 4 pts. 10,533
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 1 pt. 10,430
  7. Avatar for FamilyBarmettler 7. FamilyBarmettler 1 pt. 10,385
  8. Avatar for GENE 433 8. GENE 433 1 pt. 9,985
  9. Avatar for Australia 9. Australia 1 pt. 9,970
  1. Avatar for Cagdason 31. Cagdason Lv 1 1 pt. 9,985
  2. Avatar for AlkiP0Ps 32. AlkiP0Ps Lv 1 1 pt. 9,970
  3. Avatar for Hellcat6 33. Hellcat6 Lv 1 1 pt. 9,960
  4. Avatar for Mohoernchen 34. Mohoernchen Lv 1 1 pt. 9,831
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 1 pt. 9,824
  6. Avatar for Trajan464 36. Trajan464 Lv 1 1 pt. 9,696
  7. Avatar for gmn 37. gmn Lv 1 1 pt. 9,641
  8. Avatar for grogar7 38. grogar7 Lv 1 1 pt. 9,533
  9. Avatar for rinze 39. rinze Lv 1 1 pt. 9,415
  10. Avatar for Momuro 40. Momuro Lv 1 1 pt. 9,292

Comments