Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 9 pts. 9,756
  2. Avatar for Natural Abilities 12. Natural Abilities 7 pts. 9,666
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 9,530
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 4 pts. 9,509
  5. Avatar for SETI.Germany 15. SETI.Germany 3 pts. 9,490
  6. Avatar for Repro-men 16. Repro-men 2 pts. 9,408
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,329
  8. Avatar for Curtin Crowd 18. Curtin Crowd 1 pt. 9,141
  9. Avatar for Deleted group 19. Deleted group pts. 9,067
  10. Avatar for Crunching Family 20. Crunching Family 1 pt. 8,938
  1. Avatar for Marian90 121. Marian90 Lv 1 4 pts. 9,064
  2. Avatar for cobaltteal 122. cobaltteal Lv 1 4 pts. 9,056
  3. Avatar for Tyggy Too 123. Tyggy Too Lv 1 4 pts. 9,045
  4. Avatar for MaartenDesnouck 124. MaartenDesnouck Lv 1 4 pts. 9,043
  5. Avatar for justjustin 125. justjustin Lv 1 4 pts. 9,042
  6. Avatar for gloverd 126. gloverd Lv 1 4 pts. 9,030
  7. Avatar for Anfinsen_slept_here 127. Anfinsen_slept_here Lv 1 4 pts. 9,018
  8. Avatar for Crossed Sticks 128. Crossed Sticks Lv 1 3 pts. 9,008
  9. Avatar for parsnip 129. parsnip Lv 1 3 pts. 9,006
  10. Avatar for Tac1 130. Tac1 Lv 1 3 pts. 8,999

Comments

bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!