Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary

Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 9 pts. 9,756
  2. Avatar for Natural Abilities 12. Natural Abilities 7 pts. 9,666
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 5 pts. 9,530
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 4 pts. 9,509
  5. Avatar for SETI.Germany 15. SETI.Germany 3 pts. 9,490
  6. Avatar for Repro-men 16. Repro-men 2 pts. 9,408
  7. Avatar for Team Schleswig-Holstein 17. Team Schleswig-Holstein 1 pt. 9,329
  8. Avatar for Curtin Crowd 18. Curtin Crowd 1 pt. 9,141
  9. Avatar for Deleted group 19. Deleted group pts. 9,067
  10. Avatar for Crunching Family 20. Crunching Family 1 pt. 8,938
  1. Avatar for dembones 21. dembones Lv 1 66 pts. 9,809
  2. Avatar for drjr 22. drjr Lv 1 65 pts. 9,806
  3. Avatar for nicobul 23. nicobul Lv 1 64 pts. 9,783
  4. Avatar for Museka 24. Museka Lv 1 62 pts. 9,769
  5. Avatar for auntdeen 25. auntdeen Lv 1 61 pts. 9,765
  6. Avatar for O Seki To 26. O Seki To Lv 1 60 pts. 9,756
  7. Avatar for marie_s 27. marie_s Lv 1 58 pts. 9,744
  8. Avatar for Madde 28. Madde Lv 1 57 pts. 9,740
  9. Avatar for mimi 29. mimi Lv 1 56 pts. 9,716
  10. Avatar for silverberg 30. silverberg Lv 1 54 pts. 9,715

Comments

bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!