Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding Hand-Folding

Summary


Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups


  1. Avatar for Contenders 100 pts. 10,234
  2. Avatar for Deleted group 2. Deleted group pts. 10,202
  3. Avatar for Go Science 3. Go Science 68 pts. 10,056
  4. Avatar for Void Crushers 4. Void Crushers 55 pts. 10,012
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 44 pts. 10,005
  6. Avatar for Deleted group 6. Deleted group pts. 9,950
  7. Avatar for Beta Folders 7. Beta Folders 27 pts. 9,930
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 9,856
  9. Avatar for Russian team 9. Russian team 16 pts. 9,829
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 12 pts. 9,783

  1. Avatar for eikem 11. eikem Lv 1 82 pts. 9,886
  2. Avatar for pauldunn 12. pauldunn Lv 1 80 pts. 9,886
  3. Avatar for nemo7731 13. nemo7731 Lv 1 79 pts. 9,881
  4. Avatar for CheezWhiz 14. CheezWhiz Lv 1 77 pts. 9,873
  5. Avatar for BootsMcGraw 15. BootsMcGraw Lv 1 75 pts. 9,857
  6. Avatar for frood66 16. frood66 Lv 1 74 pts. 9,856
  7. Avatar for Sadler 17. Sadler Lv 1 72 pts. 9,829
  8. Avatar for hpaege 18. hpaege Lv 1 71 pts. 9,827
  9. Avatar for gitwut 19. gitwut Lv 1 69 pts. 9,824
  10. Avatar for spmm 20. spmm Lv 1 68 pts. 9,823

Comments


bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!