Placeholder image of a protein
Icon representing a puzzle

782: De-novo Freestyle 30: Hand-folding Round

Closed since over 12 years ago

Intermediate Overall Prediction Hand-Folding

Summary


Created
September 20, 2013
Expires
Max points
100
Description

We are giving you another currently unsolved protein as an extended chain. This round only GUI scripts are allowed and sharing has been disabled. After this puzzle expires, the puzzle will be re-posted and LUA scripts and sharing will be allowed. You'll be able to load in your solutions from this puzzle and use scripting and sharing.

Top groups


  1. Avatar for Contenders 100 pts. 10,234
  2. Avatar for Deleted group 2. Deleted group pts. 10,202
  3. Avatar for Go Science 3. Go Science 68 pts. 10,056
  4. Avatar for Void Crushers 4. Void Crushers 55 pts. 10,012
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 44 pts. 10,005
  6. Avatar for Deleted group 6. Deleted group pts. 9,950
  7. Avatar for Beta Folders 7. Beta Folders 27 pts. 9,930
  8. Avatar for Gargleblasters 8. Gargleblasters 21 pts. 9,856
  9. Avatar for Russian team 9. Russian team 16 pts. 9,829
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 12 pts. 9,783

  1. Avatar for Jim Fraser 61. Jim Fraser Lv 1 26 pts. 9,473
  2. Avatar for christioanchauvin 62. christioanchauvin Lv 1 25 pts. 9,472
  3. Avatar for jermainiac 63. jermainiac Lv 1 25 pts. 9,471
  4. Avatar for yoyo washington 64. yoyo washington Lv 1 24 pts. 9,449
  5. Avatar for pgiles 65. pgiles Lv 1 23 pts. 9,449
  6. Avatar for mirjamvandelft 66. mirjamvandelft Lv 1 23 pts. 9,441
  7. Avatar for dbuske 67. dbuske Lv 1 22 pts. 9,416
  8. Avatar for andrey 68. andrey Lv 1 22 pts. 9,410
  9. Avatar for NickyCGS 69. NickyCGS Lv 1 21 pts. 9,408
  10. Avatar for robgee 70. robgee Lv 1 20 pts. 9,405

Comments


bkoep Staff Lv 1

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep Staff Lv 1

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep Staff Lv 1

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!