Icon representing a recipe

Recipe: print protein 2.9.3

created by LociOiling

Profile


Name
print protein 2.9.3
ID
103314
Shared with
Public
Parent
print protein 2.8
Children
Created on
August 29, 2022 at 01:53 AM UTC
Updated on
August 29, 2022 at 01:53 AM UTC
Description

Update of "print protein lua2 V0" by marie_s.

Version 2.9 makes the recipe chain-aware and makes many small changes.

Version 2.9.1 is a quick fix for proline at the N terminal.

Version 2.9.2 fixes a crash on ligand puzzles.

Version 2.9.3 fixes a crash that happens when a
binder target lacks N- and C-terminals.

Best for


Code


--[[ print protein info on the protein - Concatenation of recipes, part of recipes or functions by: Tlaloc, spvincent, seagate, John McLeod, Crashguard303, Gary Forbis and authors on wiki Now with code from Timo van der Laan and and more code from spvincent. Borrowed HerobrinesArmy's idea for copy-and-paste on the segment score table, plus option for including atom and rotamer counts. Intended use: 1. Run 2. Open the script log (scriptlog.default.xml) in a text editor. 3. Strip off the start and end lines and save it as a text file with another name. 4. Import that into Excel as a comma-delimited text file. Alternately: 3. Select and copy the lines containing the score detail. 4. Paste into a spreadsheet or other program that accepts CSV (comma-separated values) format. Yet another alternative: 3. Select and copy the "score report" from the new "copy-and-paste" dialog. 4. Paste into the spreadsheet of your choice. version history --------------- print protein lua v0 - 2011/08/15 - marie_s (Marie Suchard) print protein 2.0 - 2015/05/13 - LociOiling + add dialog + use active subscores + restrict scope of most variables + convert amino acid table to keyed format + added kludges specific to puzzle 879 (hope they are never needed) + add adjustable rounding, eliminate existing "no trunc" logic + made tab the default delimiter, with comma or semicolon as alternates + add detailed scoring information + add "modifiable sections" report, make original "mutable" report optional + make "mini contact table" optional + in subscores report, add option for atom and rotamer counts, make hydropathy index optional + add warnings for unknown amino acid or secondary structure codes, subtotal mismatches, suspect ligands + and copy-and-paste dialog for subscores, primary and secondary structure print protein 2.1 - 2016/03/23 - LociOiling + add ruler print protein 2.2 - 2016/04/18 - LociOiling + fix crash in normal ligand case + add mean score to subscore display print protein 2.3 - 2016/10/27 - LociOiling + add density analysis for ED puzzles * density by amino acid * density by aromatic vs. non-aromatic * density by aliphatic vs. non-aliphatic * density by hydrophobic vs. hydrophilic * density deviation, showing whether each segment is above or below mean density for the segment's amino acid type + move less-used parms to second screen to avoid screen overflow print protein 2.4 - 2016/11/15 - LociOiling + move ED items to separate dialog to avoid textbox bug + add "active" flag to active subscores table to fix totally messed up selection logic; ripple change to GetScore print protein 2.5 - 2017/05/19 - LociOiling + fix rulers, split long lines print protein 2.6 - 2017/08/06 - LociOiling + save and restore to conserve moves print protein 2.7 - 2017/11/02 - LociOiling + consolidate duplicated segment subscore calls + add info from scoreboard and user functions print protein 2.8 - 2017/12/15 - LociOiling + handle RNA, make educated guess for DNA + include ligands in report, treat each ligand independently + add new type column, P for protein, R for RNA, D for DNA, M for molecule (ligand) + if locked segments found, include "locked" column + check for unlocked sidechains of locked segments print protein 2.8.1 - 2018/04/27 - LociOiling + short lines + chain detection + filter reporting + eliminate internal segment table, use protNfo + convert AminoAcids table to use named values (not indexed) + disulfide analysis + additional density reports sugggested by jeff101 + unreleased, density changes not finished, especially with regard to terminal regions, but several new comparisons added print protein 2.9 - 2020/03/18 - LociOiling + revived + refine filter reporting + update to SLT module + use Lua table format for modifiable sections + separate locked backbone and locked sidechain into two columns + use better separators in scriptlog + minor formatting tweaks print protein 2.9.1 - 2020/04/11 - LociOiling + handle proline at N-terminal correctly + account for cysteines as terminals in locked, zero-score positions + use multiple-pass, phased approach + remove scoreboard.GetScore, gets Rosetta for best overall, not this protein print protein 2.9.2 - 2020/07/01 - LociOiling + figure out disulfide bridges even in zero-score sections + correct DNA code for thymine, "dt", not "du" (d'oh!) (as seen in Foldit Standalone) + fix stupid crash when there's a ligand print protein 2.9.3 - 2022/08/28 - LociOiling + fix crash when binder target lacks N- or C-terminals ]]-- -- -- globals section -- Recipe = "print protein" Version = "2.9.3" ReVersion = Recipe .. " " .. Version WAYBACK = 99 -- save and restore isLigand = false subScores = {} -- subscore table gTotal = 0 -- grand total all subscores segScoreCache = {} -- current.GetSegmentEnergyScore results saved here by FindActiveSubscores subScoreCache = {} -- current.GetSegmentEnergySubscore results saved here by FindActiveSubscores BoxScore = { tSubScores = 0, -- total of active subscores, all segments tSegScores = 0, -- total of segment scores tScoreFilt = 0, -- total score, filters on tScoreFOff = 0, -- total score, filters off tScoreNrgy = 0, -- total energy score tScoreBonus = 0, -- total filter bonus tScoreForm = 0, -- subscores + filter bonus + 8000 tScoreDark = 0, -- total "dark" score } kHydro = false -- include hydropathy index kAtom = false -- include atom count kRotamer = false -- include rotamer count kLongnm = false -- include full name of amino acid or nucleobase kAbbrev = false -- include abbreviation kRound = 3 -- number of digits for rounding kFax = 10 ^ -kRound -- initial rounding factor jMaxL = 100 -- max line length for strings dtab = true delim = "\t" -- default delimiter is tab character dcomma = false -- allow user to select comma dsemic = false -- allow user to select semicolon kMutDet = false -- detailed mutable report kContact = false -- contact table kDensity = false -- density report jDensity = false -- true if density component present -- -- indexes for helixList, sheetList, structList -- STRCTTYP = 1 --structure type STRCTSTR = 2 --starting segment STRCTEND = 3 --ending segment STRCTUSE = 4 --use flag (boolean) STRCTSCR = 5 --score -- -- ligand list offsets -- LLSEG = 1 LLATM = 2 LLROT = 3 LLSCR = 4 Ctypes = { P = "protein", D = "DNA", R = "RNA", M = "ligand", } -- -- AminoAcids -- -- names and key properties of all known amino acids and nucleobases -- -- Notes: -- -- * commented entries (at the end) are not in Foldit -- * one-letter amino acid code is the table key -- * two-letter RNA and DNA nucleotides are also valid -- * the fields in this table are now referenced by name -- * the "unk" and "x" codes are considered protein, unless the segment is marked as -- ligand in the secondary structure ( code "M" ) -- * acref is atom count mid-chain, used to detect multiple peptide chains -- AminoAcids = { a = { code = "a", ctype = "P", acref = 10, short = "Ala", long = "Alanine", hydrop = 1.8 }, c = { code = "c", ctype = "P", acref = 11, short = "Cys", long = "Cysteine", hydrop = 2.5 }, d = { code = "d", ctype = "P", acref = 12, short = "Asp", long = "Aspartate", hydrop = -3.5 }, e = { code = "e", ctype = "P", acref = 15, short = "Glu", long = "Glutamate", hydrop = -3.5 }, f = { code = "f", ctype = "P", acref = 20, short = "Phe", long = "Phenylalanine", hydrop = 2.8 }, g = { code = "g", ctype = "P", acref = 7, short = "Gly", long = "Glycine", hydrop = -0.4 }, h = { code = "h", ctype = "P", acref = 17, short = "His", long = "Histidine", hydrop = -3.2 }, i = { code = "i", ctype = "P", acref = 19, short = "Ile", long = "Isoleucine", hydrop = 4.5 }, k = { code = "k", ctype = "P", acref = 22, short = "Lys", long = "Lysine", hydrop = -3.9 }, l = { code = "l", ctype = "P", acref = 19, short = "Leu", long = "Leucine", hydrop = 3.8 }, m = { code = "m", ctype = "P", acref = 17, short = "Met", long = "Methionine ", hydrop = 1.9 }, n = { code = "n", ctype = "P", acref = 14, short = "Asn", long = "Asparagine", hydrop = -3.5 }, p = { code = "p", ctype = "P", acref = 15, short = "Pro", long = "Proline", hydrop = -1.6 }, q = { code = "q", ctype = "P", acref = 17, short = "Gln", long = "Glutamine", hydrop = -3.5 }, r = { code = "r", ctype = "P", acref = 24, short = "Arg", long = "Arginine", hydrop = -4.5 }, s = { code = "s", ctype = "P", acref = 11, short = "Ser", long = "Serine", hydrop = -0.8 }, t = { code = "t", ctype = "P", acref = 14, short = "Thr", long = "Threonine", hydrop = -0.7 }, v = { code = "v", ctype = "P", acref = 16, short = "Val", long = "Valine", hydrop = 4.2 }, w = { code = "w", ctype = "P", acref = 24, short = "Trp", long = "Tryptophan", hydrop = -0.9 }, y = { code = "y", ctype = "P", acref = 21, short = "Tyr", long = "Tyrosine", hydrop = -1.3 }, -- -- codes for ligands or modified amino acids -- x = { code = "x", ctype = "P", acref = 0, short = "Xaa", long = "Unknown", hydrop = 0 }, unk = { code = "x", ctype = "P", acref = 0, short = "Xaa", long = "Unknown", hydrop = 0 }, -- -- bonus! RNA nucleotides -- ra = { code = "a", ctype = "R", acref = 33, short = "a", long = "Adenine", hydrop = 0, }, rc = { code = "c", ctype = "R", acref = 31, short = "c", long = "Cytosine", hydrop = 0, }, rg = { code = "g", ctype = "R", acref = 34, short = "g", long = "Guanine", hydrop = 0, }, ru = { code = "u", ctype = "R", acref = 30, short = "u", long = "Uracil", hydrop = 0, }, -- -- bonus! DNA nucleotides -- da = { code = "a", ctype = "D", acref = 0, short = "a", long = "Adenine", hydrop = 0, }, dc = { code = "c", ctype = "D", acref = 0, short = "c", long = "Cytosine", hydrop = 0, }, dg = { code = "g", ctype = "D", acref = 0, short = "g", long = "Guanine", hydrop = 0, }, dt = { code = "t", ctype = "D", acref = 0, short = "t", long = "Thymine", hydrop = 0, }, -- -- dusty attic! musty cellar! jumbled boxroom! -- can't bear to part with these treasures -- -- b = { code = "b", ctype = "P", acref = 10, short = "Asx", long = "Asparagine/Aspartic acid", hydrop = 0 }, -- j = { code = "j", ctype = "P", acref = 10, short = "Xle", long = "Leucine/Isoleucine", hydrop = 0 }, -- o = { code = "o", ctype = "P", acref = 10, short = "Pyl", long = "Pyrrolysine", hydrop = 0 }, -- u = { code = "u", ctype = "P", acref = 10, short = "Sec", long = "Selenocysteine", hydrop = 0 }, -- z = { code = "z", ctype = "P", acref = 10, short = "Glx", long = "Glutamine or glutamic acid", hydrop = 0 } , } -- -- amino acid types -- Aromatic = { f = { "phenylalanine", }, h = { "histidine", }, w = { "tryptophan", }, y = { "tyrosine", }, } Aliphatic = { i = { "isoleucine", }, l = { "leucine", }, v = { "valine", }, } Hydrophobic = { a = { "alanine", }, c = { "cysteine", }, f = { "phenylalanine", }, i = { "isoleucine", }, l = { "leucine", }, m = { "methionine", }, p = { "proline", }, v = { "valine", }, w = { "tryptophan", }, y = { "tyrosine", }, } -- -- amino acids which normally have one rotamer -- if other AAs report one rotamer, it may -- indicate a locked sidechain -- OneRotamer = { a = { "alanine", }, g = { "glycine", }, } -- -- end of globals section -- -- -- begin protNfo Beta package version 0.5 -- -- version 0.4 is packaged as a psuedo-class or psuedo-module -- containing a mix of data fields and functions -- -- all entries must be terminated with a comma to keep Lua happy -- -- the commas aren't necessary if only function definitions are present -- -- version 0.3 merges in the chain-detection logic developed in -- AA Edit 2.0 -- -- version 0.4 merges in the ligand logic from GetSeCount -- -- version 0.5 is still a work in progress -- -- TODO: still depends heavily on the external AminoAcids table -- -- protNfo = { PROTEIN = "P", LIGAND = "M", RNA = "R", DNA = "D", UNKNOWN_AA = "x", UNKNOWN_BASE = "xx", CYSTEINE_AA = "c", CYS_MID_BRIDGE = 10, -- atom count for midchain disulfide bridge CYS_AMBIGUOUS1 = 11, -- atom count for C terminal bridge or midchain, no bridge CYS_AMBIGUOUS2 = 12, -- atom count for N terminal bridge or C terminal, no bridge CYS_N_NO_BRIDGE = 13, -- atom count for N terminal, no disulfide bridge PROLINE_AA = "p", HELIX = "H", SHEET = "E", LOOP = "E", segCnt = 0, -- unadjusted segment count segCnt2 = 0, -- segment count adjusted for terminal ligands aa = {}, -- amino acid codes ss = {}, -- secondary structure codes atom = {}, -- atom counts rot = {}, -- rotamer counts phobe = {}, -- hydrophobics lock = {}, -- locked segments slck = {}, -- locked sidechains mute = {}, -- mutable segments ctype = {}, -- segment type - P, M, R, D first = {}, -- true if segment is first in chain last = {}, -- true if segment is last in chain nterm = {}, -- true if protein and if n-terminal cterm = {}, -- true if protein and if c-terminal fastac = {}, -- external code for FASTA-style output short = {}, -- short name long = {}, -- long name hydrop = {}, -- hydropathy index chainid = {}, -- chain id chainpos = {}, -- position in chain cysteine = {}, -- cysteines chains = {}, -- summary of chains ligands = {}, -- ligand table getChains = function ( self ) -- -- getChains - build a table of the chains found -- -- Most Foldit puzzles contain only a single protein (peptide) chain. -- A few puzzles contain ligands, and some puzzles have had two -- protein chains. Foldit puzzles may also contain RNA or DNA. -- -- For proteins, the atom count can be used to identify the first -- (N terminal) and last (C terminal) ends of the chain. The AminoAcids -- table has the mid-chain atom counts for each amino acid. -- -- Cysteine is a special case, since the presence of a disulfide -- bridge also changes the atom count. -- -- For DNA and RNA, the beginning and end of the chain is determined -- by context at present. For example, if the previous segment was protein -- and this segment is DNA, it's the start of a chain. -- -- Each ligand is treated as a chain of its own, with a length of 1. -- -- chain table entries -- ------------------- -- -- ctype - chain type - "P" for protein, "M" for ligand, "R" for RNA, "D" for DNA -- fasta - FASTA-format sequence, single-letter codes (does not include FASTA header) -- start - Foldit segment number of sequence start -- stop - Foldit segment number of sequence end -- len - length of sequence -- chainid - chain id assigned to entry, "A", "B", "C", and so on -- -- For DNA and RNA, fasta contains single-letter codes, so "a" for adenine. -- The codes overlap the amino acid codes (for example, "a" for alanine). -- The DNA and RNA codes must be converted to the appropriate two-letter codes Foldit -- uses internally, for example "ra" for RNA adenine and "da" for DNA adenine. -- -- -- we're assuming Foldit won't ever have more chains -- local chainid = { "A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z" } local chainz = {} local chindx = 0 local curchn = nil for ii = 1, self.segCnt do if self.first [ ii ] then chindx = chindx + 1 chainz [ chindx ] = {} curchn = chainz [ chindx ] curchn.ctype = self.ctype [ ii ] curchn.fasta = "" curchn.ss = "" curchn.start = ii curchn.chainid = chainid [ chindx ] curchn.mute = 0 curchn.len = 0 end curchn.fasta = curchn.fasta .. self.fastac [ ii ] curchn.ss = curchn.ss .. self.ss [ ii ] self.chainid [ #self.chainid + 1 ] = curchn.chainid self.chainpos [ #self.chainpos + 1 ] = ii - curchn.start + 1 if self.mute [ ii ] then curchn.mute = curchn.mute + 1 end if self.last [ ii ] then curchn.stop = ii curchn.len = curchn.stop - ( curchn.start - 1 ) end end return chainz end, getLigands = function ( self ) -- -- ultra-paranoid method for detecting ligands -- -- each ligand segment is treated separately in this version -- local ligandz = {} for ii = 1, self.segCnt do if protNfo.ss [ ii ] == "M" then local atoms = protNfo.atom [ ii ] local rots = protNfo.rot [ ii ] local sscor = current.GetSegmentEnergyScore ( ii ) ligandz [ #ligandz + 1 ] = { ii, atoms, rots, sscor } end end print ( #ligandz .. " ligands" ) for jj = 1, #ligandz do print ( "ligand # " .. jj .. ", segment = " .. ligandz [ jj ] [ LLSEG ] .. ", atoms = " .. ligandz [ jj ] [ LLATM ] .. ", rotamers = " .. ligandz [ jj ] [ LLROT ] .. ", score = " .. round ( ligandz [ jj ] [ LLSCR ] ) ) if ligandz [ jj ] [ LLSEG ] < self.segCnt2 then print ( "WARNING: non-standard ligand at segment " .. ligandz [ jj ] [ LLSEG ] .. ", most ligand-aware recipes won't work properly" ) end end return ligandz end, setNfo = function ( self ) self.segCnt = structure.GetCount() -- -- standard ligand adjustment -- self.segCnt2 = self.segCnt while protNfo.ss [ self.segCnt2 ] == "M" do self.segCnt2 = self.segCnt2 - 1 end if self.segCnt2 == self.segCnt then print ( "segment count = " .. self.segCnt ) else print ( "original segment count = " .. self.segCnt ) print ( "adjusted segment count = " .. self.segCnt2 ) end -- -- initial scan - retrieve basic info from Foldit and AminoAcids table -- for ii = 1, self.segCnt do self.aa [ #self.aa + 1 ] = structure.GetAminoAcid ( ii ) self.ss [ #self.ss + 1 ] = structure.GetSecondaryStructure ( ii ) self.atom [ #self.atom + 1 ] = structure.GetAtomCount ( ii ) self.rot [ #self.rot + 1 ] = rotamer.GetCount ( ii ) self.phobe [ #self.phobe + 1 ] = structure.IsHydrophobic ( ii ) self.lock [ #self.lock + 1 ] = structure.IsLocked ( ii ) self.mute [ #self.mute + 1 ] = structure.IsMutable ( ii ) -- -- take a stab at those locked sidechains -- local slk = false if OneRotamer [ self.aa [ ii ] ] == nil and self.rot [ ii ] <= 1 then slk = true end self.slck [ #self.slck + 1 ] = slk -- -- look it up -- local aatab = AminoAcids [ self.aa [ ii ] ] if aatab ~= nil then self.ctype [ #self.ctype + 1 ] = aatab.ctype -- -- even the codes 'x' or 'unk' are considered protein -- unless the secondary structure is "M" -- -- this handles glycosylated amino acids -- in puzzles 879, 1378b, and similar -- -- segment 134 in puzzle 879 is the example, -- it's no longer asparagine, but it is part of -- the peptide chain -- if self.ss [ ii ] == self.LIGAND then self.ctype [ ii ] = self.LIGAND end -- -- other info -- else -- -- special case: unknown code - mark it as ligand -- -- this should not occur, but just in case -- self.ctype [ #self.ctype + 1 ] = self.LIGAND aa = self.UNKNOWN_AA -- a known unknown aatab = AminoAcids [ aa ] end self.short [ #self.short + 1 ] = aatab.short self.long [ #self.long + 1 ] = aatab.long self.hydrop [ #self.hydrop + 1 ] = aatab.hydrop self.fastac [ #self.fastac + 1 ] = aatab.code self.nterm [ #self.nterm + 1 ] = false self.cterm [ #self.cterm + 1 ] = false -- -- build table of cysteines -- if self.aa [ ii ] == self.CYSTEINE_AA then local ds = current.GetSegmentEnergySubscore ( ii, "Disulfides" ) self.cysteine [ #self.cysteine + 1 ] = { seg1 = ii, seg2 = nil, bonded = false, score = ds, } end end -- end of initial scan -- -- analyze cysteines, don't rely on disfulide subscore -- if #self.cysteine > 0 then local bridges = 0 local cstring = "" local cref = AminoAcids [ self.CYSTEINE_AA ].acref -- reference atom count for ii = 1, #self.cysteine do local c1 = self.cysteine [ ii ].seg1 for jj = ii + 1, #self.cysteine do local c2 = self.cysteine [ jj ].seg1 if c1 ~= c2 then -- -- measure the distance between tip sulfurs -- local a1 = 6 local a2 = 6 if self.cterm [ c1 ] then a1 = a1 + 1 end if self.cterm [ c2 ] then a2 = a2 + 1 end local bnd = band.AddBetweenSegments ( c1, c2, a1, a2 ) if bnd ~= nil and bnd ~= 0 then local dst = band.GetLength ( bnd ) local diff = dst - 2.0 if math.abs ( diff ) < 0.2 then --[[ print ( "disulfide bridge " .. c1 .. "-" .. c2 .. ", tip distance = " .. round ( dst ) ) ]]-- cstring = cstring .. c1 .. "," .. c2 .. " " bridges = bridges + 1 self.cysteine [ ii ].bonded = true self.cysteine [ ii ].seg2 = c2 self.cysteine [ jj ].bonded = true self.cysteine [ jj ].seg2 = c1 end band.Delete ( bnd ) end end end end if bridges > 0 then print ( bridges .. " disulfide bridges found, segment pairs = " ) print ( cstring ) end end -- -- rescan to determine first and last in chain for all types -- it's necessary to "peek" at neighbors for DNA and RNA -- for ii = 1, self.segCnt do local nterm = self.nterm [ ii ] local cterm = self.cterm [ ii ] local first = false local last = false if ii == 1 then first = true end if ii == self.segCnt then last = true end -- -- for proteins, determine n-terminal and c-terminal -- based on atom count -- if self.ctype [ ii ] == self.PROTEIN then local ttyp = "" local noteable = false local aatab = AminoAcids [ self.aa [ ii ] ] local ac = self.atom [ ii ] -- actual atom count local act = aatab.acref -- reference mid-chain atom count if ac ~= act or ( self.aa [ ii ] == self.CYSTEINE_AA and ac == act ) then ttyp = "non-standard amino acid" if ac == act + 2 then ttyp = "N-terminal" nterm = true notable = true elseif ac == act + 1 then ttyp = "C-terminal" cterm = true notable = true elseif self.aa [ ii ] == self.PROLINE_AA and ac == act + 3 then ttyp = "N-terminal" nterm = true notable = true end if self.aa [ ii ] == self.CYSTEINE_AA then local ds = current.GetSegmentEnergySubscore ( ii, "Disulfides" ) local bonded = false --print ( "cysteine at " .. ii .. ", disulfides score = " .. ds ) if ds ~= 0 and math.abs ( ds ) > 0.01 then bonded = true nterm = false cterm = false ttyp = "disulfide bridge" notable = false if ac == act + 1 then ttyp = "N-terminal" nterm = true notable = true elseif ac == act then ttyp = "C-terminal" cterm = true notable = true end else for xx = 1, self.segCnt do local aax = structure.GetAminoAcid ( xx ) -- duplicated effort! if xx ~= ii and aax == self.CYSTEINE_AA then local bx = band.AddBetweenSegments ( ii, xx, 6, 6 ) if bx ~= nil and bx ~= 0 then local bl = band.GetLength ( bx ) if bl >= 1.9 and bl <= 2.2 then bonded = true if ac == act + 1 then ttyp = "N-terminal" nterm = true notable = true elseif ac == act then ttyp = "C-terminal" cterm = true notable = true end end band.Delete ( bx ) end end if bonded then break end end if not bonded then ttyp = "unpaired cysteine" notable = false end end self.cysteine [ #self.cysteine + 1 ] = { ii, bonded, {}, } end if notable then print ( ttyp .. " detected at segment " .. ii .. ", amino acid = \'" .. self.aa [ ii ] .. "\', atom count = " .. ac .. ", reference count = " .. act .. ", secondary structure = " .. self.ss [ ii ] ) end end end -- -- set results from first pass -- self.nterm [ ii ] = nterm self.cterm [ ii ] = cterm -- -- second-guessing -- if self.ctype [ ii ] == self.PROTEIN then if self.nterm [ ii ] then first = true end if self.cterm [ ii ] then last = true end -- -- kludge for cases where binder target doesn't -- have an identifiable C terminal -- if ii < self.segCnt then if self.ctype [ ii ] == self.PROTEIN or ( self.ctype [ ii ] == self.PROTEIN and self.nterm [ ii + 1 ] ) then last = true end end -- -- special cases for puzzles 879, 1378b, and similar -- -- if modified AA ends or begins a chain, mark -- it as C-terminal or N-terminal -- -- hypothetical: no way to test so far! -- if AminoAcids [ self.aa [ ii ] ] [ AACODE ] == self.UNKNOWN_AA then if ii > 1 then -- -- if previous segment was not protein, this segment is an n-terminal -- if self.ctype [ ii - 1 ] ~= self.ctype [ ii ] then first = true self.nterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as N-terminal (previous segment non-protein)" ) -- -- if previous segment is protein and a c-terminal, -- this segment is an n-terminal elseif ii > 1 and self.cterm [ ii - 1 ] then first = true self.nterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as N-terminal (previous segment C-terminal)" ) end end if ii < self.segCnt then -- -- if next segment is not protein, this is a c-terminal -- if self.ctype [ ii + 1 ] ~= self.ctype [ ii ] then last = true self.cterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as C-terminal (next segment non-protein)" ) -- -- if next segment is protein and an n-terminal, -- this segment is a c-terminal -- elseif ii < self.segCnt and self.nterm [ ii + 1 ] then last = true self.cterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as C-terminal (next segment N-terminal)" ) end end end elseif self.ctype [ ii ] == self.DNA or self.ctype [ ii ] == self.RNA then if ii > 1 and self.ctype [ ii - 1 ] ~= self.ctype [ ii ] then first = true end if ii < self.segCnt and self.ctype [ ii + 1 ] ~= self.ctype [ ii ] then last = true end else -- ligand first = true last = true end self.first [ #self.first + 1 ] = first self.last [ #self.last + 1 ] = last end -- -- summarize the chain info -- self.chains = self:getChains () -- -- get the ligand info -- self.ligands = self:getLigands () end, } -- -- end protNfo Beta package version 0.3 -- -- -- function print score by spvincent -- function round ( x ) if x == nil then return "nil" end return x - x % kFax end SLT = { -- SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT-- --[[ SLT - Segment set, list, and type module v0.5.pp (special for print protein) Includes the segment set and list module and the segment type module developed by Timo van der Laan. The following Foldit recipes contain the original code for these modules: * Tvdl enhanced DRW 3.1.1 - https://fold.it/portal/recipe/102840 * TvdL DRemixW 3.1.2 - https://fold.it/portal/recipe/102398 The "set and list" module performs logical operations and transformations on tables containing ranges of segment. The segment type module find lists and sets of segments with various properties, such as selected or frozen. A "list" is one-dimensional table containing segment numbers. A "set" is a two-dimensional table containing segment number ranges. For example, given a list of segments: list = { 1, 2, 3, 7, 8, 11, 13, 14, 15 } the corresponding set is: set = { { 1, 3 }, { 7, 8 }, { 11, 11 }, {13, 15 } } Most functions assume that the sets are well-formed, meaning they are ordered and have no overlaps. As an example, the method FindUnlocked returns a set of all the unlocked segments in a puzzle. The method can be called as follows: funlocked = SLT:FindUnlocked () The return value funlocked is a two-dimensional table containing ranges of unlocked segments. In source format, the table might look like this: funlocked = { { 27, 35, }, { 47, 62, }, { 78, 89, }, } The code to use this table would look like: -- -- for each range of segments -- for ii = 1, #funlocked do -- -- for each segment in the range, so something -- for jj = funlocked [ ii ] [ 1 ], funlocked [ ii ] [ 2 ] do ... something ... end end This psuedo-module is a table containing a mix of data fields and methods. This wiki article explains the packaging technique: https://foldit.fandom.com/wiki/Lua_packaging_for_Foldit Authorship ---------- Original by Timo van der Laan: 02-05-2012 TvdL Free to use for non commercial purposes French comments by Bruno Kestemont and perhaps others. v0.1 - LociOiling + extract and reformat code v0.2 - LociOiling - 2017/11/03 + add primary FindUnlocked function v0.3 - LociOiling + add FindRotamers function v0.4 - LociOiling - 2019/10/29 + package as table + remove dependencies on segCnt and segCnt2 v0.5 - LociOiling - 2019/12/17 + convert functions to methods, update internal references v0.5.pp - LociOiling - 2020/03/16 + special version for print protein ]]-- -- -- variables -- segCnt = nil, -- segment count, not adjusted for ligands segCnt2 = nil, -- segment count, not including terminal ligands -- -- initializer - can be called externally, but invoked inline if segCnt or segCnt2 are nil -- Init = function ( self ) self.segCnt = structure.GetCount () self.segCnt2 = self.segCnt while structure.GetSecondaryStructure ( self.segCnt2 ) == "M" do self.segCnt2 = self.segCnt2 - 1 end end, -- -- segment set and list functions -- SegmentListToSet = function ( self, list ) -- retirer doublons local result = {} local ff = 0 local ll = -1 table.sort ( list ) for ii = 1, #list do if list [ ii ] ~= ll + 1 and list [ ii ] ~= ll then -- note: duplicates are removed if ll > 0 then result [ #result + 1 ] = { ff, ll } end ff = list [ ii ] end ll = list [ ii ] end if ll > 0 then result [ #result + 1 ] = { ff, ll } end return result end, SegmentSetToList = function ( self, set ) -- faire une liste a partir d'une zone local result = {} for ii = 1, #set do for kk = set [ ii ] [ 1 ], set [ ii ] [ 2 ] do result [ #result + 1 ] = kk end end return result end, SegmentCleanSet = function ( self, set ) -- Makes it well formed return self:SegmentListToSet ( self:SegmentSetToList ( set ) ) end, SegmentInvertSet = function ( self, set, maxseg ) -- -- Gives back all segments not in the set -- maxseg is added for ligand -- local result={} if maxseg == nil then maxseg = structure.GetCount () end if #set == 0 then return { { 1, maxseg } } end if set [ 1 ] [ 1 ] ~= 1 then result [ 1 ] = { 1, set [ 1 ] [ 1 ] - 1 } end for ii = 2, #set do result [ #result + 1 ] = { set [ ii - 1 ] [ 2 ] + 1, set [ ii ] [ 1 ] - 1, } end if set [ #set ] [ 2 ] ~= maxseg then result [ #result + 1 ] = { set [ #set ] [ 2 ] + 1, maxseg } end return result end, SegmentInvertList = function ( self, list ) if self.segCnt2 == nil then self:Init () end table.sort ( list ) local result = {} for ii = 1, #list - 1 do for jj = list [ ii ] + 1, list [ ii + 1 ] - 1 do result [ #result + 1 ] = jj end end for jj = list [ #list ] + 1, self.segCnt2 do result [ #result + 1 ] = jj end return result end, SegmentInList = function ( self, seg, list ) -- verifier si segment est dans la liste table.sort ( list ) for ii = 1, #list do if list [ ii ] == seg then return true elseif list [ ii ] > seg then return false end end return false end, SegmentInSet = function ( self, set, seg ) --verifie si segment est dans la zone for ii = 1, #set do if seg >= set [ ii ] [ 1 ] and seg <= set [ ii ] [ 2 ] then return true elseif seg < set [ ii ] [ 1 ] then return false end end return false end, SegmentJoinList = function ( self, list1, list2 ) -- fusionner 2 listes de segments local result = list1 if result == nil then return list2 end for ii = 1, #list2 do result [ #result + 1 ] = list2 [ ii ] end table.sort ( result ) return result end, SegmentJoinSet = function ( self, set1, set2 ) --fusionner (ajouter) 2 zones return self:SegmentListToSet ( self:SegmentJoinList ( self:SegmentSetToList ( set1 ), self:SegmentSetToList ( set2 ) ) ) end, SegmentCommList = function ( self, list1, list2 ) -- chercher intersection de 2 listes local result = {} table.sort ( list1 ) table.sort ( list2 ) if #list2 == 0 then return result end local jj = 1 for ii = 1, #list1 do while list2 [ jj ] < list1 [ ii ] do jj = jj + 1 if jj > #list2 then return result end end if list1 [ ii ] == list2 [ jj ] then result [ #result + 1 ] = list1 [ ii ] end end return result end, SegmentCommSet = function ( self, set1, set2 ) -- intersection de 2 zones return self:SegmentListToSet ( self:SegmentCommList ( self:SegmentSetToList ( set1 ), self:SegmentSetToList ( set2 ) ) ) end, SegmentSetMinus = function ( self, set1, set2 ) return self:SegmentCommSet ( set1, self:SegmentInvertSet ( set2 ) ) end, SegmentPrintSet = function ( self, set ) print ( self:SegmentSetToString ( set ) ) end, SegmentSetToString = function ( self, set ) -- pour pouvoir imprimer local line = "" for ii = 1, #set do if ii ~= 1 then line = line .. ", " end line = line .. set [ ii ] [ 1 ] .. "-" .. set [ ii ] [ 2 ] end return line end, SegmentSetInSet = function ( self, set, sub ) if sub == nil then return true end -- -- Checks if sub is a proper subset of set -- for ii = 1, #sub do if not self:SegmentRangeInSet ( set, sub [ ii ] ) then return false end end return true end, SegmentRangeInSet = function ( self, set, range ) -- verifier si zone est dans suite if range == nil or #range == 0 then return true end local bb = range [ 1 ] local ee = range [ 2 ] for ii = 1, #set do if bb >= set [ ii ] [ 1 ] and bb <= set [ ii ] [ 2 ] then return ( ee <= set [ ii ] [ 2 ] ) elseif ee <= set [ ii ] [ 1 ] then return false end end return false end, SegmentSetToBool = function ( self, set ) --vrai ou faux pour chaque segment utilisable ou non local result = {} for ii = 1, structure.GetCount () do result [ ii ] = self:SegmentInSet ( set, ii ) end return result end, -- -- End of Segment Set module -- -- -- Module Find Segment Types -- FindMutablesList = function ( self ) if self.segCnt2 == nil then self:Init () end local result = {} for ii = 1, self.segCnt2 do if structure.IsMutable ( ii ) then result [ #result + 1 ] = ii end end return result end, FindMutables = function ( self ) return self:SegmentListToSet ( self:FindMutablesList () ) end, FindFrozenList = function ( self ) if self.segCnt2 == nil then self:Init () end local result = {} for ii = 1, self.segCnt2 do if freeze.IsFrozen ( ii ) then result [ #result + 1 ] = ii end end return result end, FindFrozen = function ( self ) return self:SegmentListToSet ( self:FindFrozenList () ) end, FindLockedList = function ( self ) if self.segCnt2 == nil then self:Init () end local result = {} for ii = 1, self.segCnt2 do if structure.IsLocked ( ii ) then result [ #result + 1 ] = ii end end return result end, FindLocked = function ( self ) return self:SegmentListToSet ( self:FindLockedList () ) end, FindUnlockedList = function ( self ) if self.segCnt2 == nil then self:Init () end local result = {} for ii = 1, self.segCnt2 do if not structure.IsLocked ( ii ) then result [ #result + 1 ] = ii end end return result end, FindUnlocked = function ( self ) return self:SegmentListToSet ( self:FindUnlockedList () ) end, FindSLockedList = function ( self ) local result = {} for ii = 1, self.segCnt do -- -- special mod for print protein: use slck -- if protNfo.slck [ ii ] then result [ #result + 1 ] = ii end end return result end, FindSLocked = function ( self ) return SLT:SegmentListToSet ( SLT:FindSLockedList () ) end, FindZeroScoreList = function ( self ) if self.segCnt == nil then self:Init () end local result = {} for ii = 1, self.segCnt do local sub = 0 for jj = 1, #subScores do -- sub = sub + current.GetSegmentEnergySubscore ( ii, subScores [ jj ] [ 1 ] ) -- -- special mod for print protein: use subScoreCache -- sub = sub + subScoreCache [ subScores [ jj ] [ 1 ] ] [ ii ] end if sub == 0 then result [ #result + 1 ] = ii end end return result end, FindZeroScore = function ( self ) return self:SegmentListToSet ( self:FindZeroScoreList () ) end, FindRotamersList = function ( self ) if self.segCnt == nil then self:Init () end local result = {} for ii = 1, self.segCnt do local rots = rotamer.GetCount ( ii ) if rots > 1 then result [ #result + 1 ] = ii end end return result end, FindRotamers = function ( self ) return self:SegmentListToSet ( self:FindRotamersList () ) end, FindSelectedList = function ( self ) if self.segCnt == nil then self:Init () end local result = {} for ii = 1, self.segCnt do if selection.IsSelected ( ii ) then result [ #result + 1 ] = ii end end return result end, FindSelected = function ( self ) return self:SegmentListToSet ( self:FindSelectedList () ) end, FindAAtypeList = function ( self, aa ) if self.segCnt2 == nil then self:Init () end local result = {} for ii = 1, self.segCnt2 do if structure.GetSecondaryStructure ( ii ) == aa then result [ #result + 1 ] = ii end end return result end, FindAAtype = function ( self, aa ) return self:SegmentListToSet ( self:FindAAtypeList ( aa ) ) end, FindAminotype = function ( self, at ) --NOTE: only this one gives a list not a set if self.segCnt2 == nil then self:Init () end local result={} for ii = 1, self.segCnt2 do if structure.GetAminoAcid ( ii ) == at then result [ #result + 1 ] = ii end end return result end, }-- SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT--SLT-- function divline () print ( "========================================" ) end function makeruler ( sBeg, sEnd, title, inverted, last ) if title == nil then title = "" end if inverted == nil then inverted = false end if last == nil then last = false end local function tenpart ( ff ) if ff >= 100 then ff = ff % 100 end return ( ff - ( ff % 10 ) ) / 10 end local function hunpart ( ff ) if ff >= 1000 then ff = ff % 1000 end return ( ff - ( ff % 100 ) ) / 100 end local onez = "" local tenz = "" local hunz = "" local numz = sBeg % 10 for ii = sBeg, sEnd do onez = onez .. numz % 10 if ii % 10 == 0 then tenz = tenz .. tenpart ( ii ) if ii >= 100 then hunz = hunz .. hunpart ( ii ) else hunz = hunz .. " " end else if ii == sBeg and ii > 1 then tenz = tenz .. tenpart ( ii ) hunz = hunz .. hunpart ( ii ) else tenz = tenz .. " " hunz = hunz .. " " end end numz = numz + 1 if numz > 10 then numz = 1 end end if last then tenz = tenz:sub ( 1, tenz:len () - 1 ) .. tenpart ( sEnd ) hunz = hunz:sub ( 1, hunz:len () - 1 ) .. hunpart ( sEnd ) end local ruler = "" if not inverted and sEnd >= 100 then ruler = ruler .. hunz .. "\n" end if not inverted and sEnd >= 10 then ruler = ruler .. tenz .. "\n" end ruler = ruler .. onez ruler = ruler .. " " .. title .. " " .. sBeg .. "-" .. sEnd if inverted then ruler = ruler .. "\n" end if inverted and sEnd >= 10 then ruler = ruler .. tenz .. "\n" end if inverted and sEnd >= 100 then ruler = ruler .. hunz end return ruler end function linotype ( line, seg ) -- -- pp 2.9 - new optional "seg" for Foldit segment #, -- adds second ruler -- local title1 = "segment/residue" local title2 = "segment" if seg == nil then seg = 1 end local invert = false if seg ~= 1 then invert = true title1 = "residue" end local len = line:len () local maxL = math.min ( len, jMaxL ) if line:len () > maxL then print ( line ) print ( "" ) end for ii = 1, len, maxL do local lastseg = math.min ( ii + jMaxL - 1, len ) local linelen = lastseg - ii + 1 local last = false if lastseg >= len then last = true end print ( makeruler ( ii, lastseg, title1, false, last ) ) if invert then print ( "" ) end print ( line:sub ( ii, lastseg ) ) if invert then print ( "" ) end if invert then print ( makeruler ( seg, seg + linelen - 1, title2, true, last ) ) seg = seg + maxL end print ( "" ) end end -- -- tlaloc functions to print sequence of letter -- function BuildSequence ( start, stop ) local seqstring = "" local hydrostring = "" local strucstring = "" local stypestring = "" local lockstring = "" local slockstring = "" local nonp = 0 local locks = 0 local slocks = 0 for ii = start, stop do local aac = protNfo.fastac [ ii ] if protNfo.ctype [ ii ] ~= protNfo.PROTEIN then nonp = nonp + 1 end seqstring = seqstring .. aac if protNfo.phobe [ ii ] then hydrostring = hydrostring .. "i" else hydrostring = hydrostring .. "e" end strucstring = strucstring .. protNfo.ss [ ii ] stypestring = stypestring .. protNfo.ctype [ ii ] local locked = "U" if protNfo.lock [ ii ] then locked = "L" locks = locks + 1 end lockstring = lockstring .. locked local slocked = "U" if protNfo.slck [ ii ] then slocked = "L" slocks = slocks + 1 end slockstring = slockstring .. slocked end -- -- return values -- -- primary structure -- hydro -- secondary structure -- type -- lock -- sidechain lock -- #non-protein segments -- #locked segments -- #locked sidechains -- return seqstring, hydrostring, strucstring, stypestring, lockstring, slockstring, nonp, locks, slocks end -- -- find modifiable sections -- -- pp 2.9 - use Lua table format, report segment ranges -- function FindModifiable () local function prtrange ( rname, range ) if range == nil or #range == 0 then return end print ( "--" ) print ( #range .. " " .. rname .. " sections" ) rname = rname:gsub ( " ", "_" ) rname = rname:gsub ( ",", "" ) print ( rname .. " = {" ) for kk = 1, #range do print ( " { " .. range [ kk ] [ 1 ] .. ", " .. range [ kk ] [ 2 ] .. ", }," ) end print ( "}" ) end -- local flocked = SLT:FindLocked () prtrange ( "locked", flocked ) -- local funlocked = SLT:SegmentInvertSet ( flocked ) prtrange ( "unlocked", funlocked ) -- local fslocked = SLT:FindSLocked () prtrange ( "locked sidechain", fslocked ) -- local fsunlocked = SLT:SegmentInvertSet ( fslocked ) prtrange ( "unlocked sidechain", fsunlocked ) -- local ulckblcks = SLT:SegmentCommSet ( funlocked, fslocked ) prtrange ( "unlocked backbone, locked sidechain", ulckblks ) -- local zeroScore = SLT:FindZeroScore () prtrange ( "zero score", zeroScore ) -- if #flocked == 1 and #zeroScore > 0 then local LockedNZ = SLT:SegmentInvertSet ( zeroScore, flocked [ 1 ] [ 2 ] ) prtrnange ( "locked, non-zero score", LockedNZ ) end -- local mutables = SLT:FindMutables () prtrange ( "mutable", mutables ) -- local lockmut = SLT:SegmentCommSet ( flocked, mutables ) prtrange ( "locked, mutable", lockmut ) end -- -- find mutable segments -- function FindMutable ( ) local mutable = {} local mutablestring = '' for ii = 1, protNfo.segCnt2 do if protNfo.mute [ ii ] == true then mutable [ #mutable + 1 ] = ii end end print ( #mutable .. " mutables found" ) if #mutable > 0 then print ( "n" .. delim .. "segment" .. delim .. "aacode" .. delim .. "aaname" ) end for ii = 1, #mutable do print ( ii .. delim .. mutable [ ii ] .. delim .. protNfo.aa [ mutable [ ii ] ] .. delim .. protNfo.long [ mutable [ ii ] ] ) mutablestring = mutablestring .. "'" .. protNfo.aa [ mutable [ ii ] ] .. "'," end print ( mutablestring ) --- for copy paste on other recipe return mutable end -- -- function FindActiveSubscores adapted from EDRW by Timo van der Laan -- -- This function should be called first -- it saves segment scores and subscores -- in segScoreCache and subScoreCache. -- function FindActiveSubscores () local result = {} local gTotal = 0 -- grand total all subscores local gTotalS = 0 -- grand total all segment subscores local Subs = puzzle.GetPuzzleSubscoreNames () local soot = "" for ii = 1, #Subs do subScoreCache [ Subs [ ii ] ] = {} -- save for later local total = 0 local abstotal = 0 local part for jj = 1, protNfo.segCnt do part = current.GetSegmentEnergySubscore ( jj, Subs [ ii ] ) subScoreCache [ Subs [ ii ] ] [ jj ] = part total = total + part abstotal = abstotal + math.abs ( part ) end if abstotal > 10 then result [ #result + 1 ] = { Subs [ ii ], total, true } gTotal = gTotal + total soot = soot .. "#" .. #result .. ": " .. Subs [ ii ] .. ", total = " .. round ( total ) .. "\n" end end for ii = 1, protNfo.segCnt do segScoreCache [ #segScoreCache + 1 ] = current.GetSegmentEnergyScore ( ii ) gTotalS = gTotalS + segScoreCache [ ii ] end -- -- create pseudo scoreparts -- -- in effect: -- -- Subs [ #Subs + 1 ] = "Subtotal" -- total of all scoreparts per segment -- Subs [ #Subs + 1 ] = "Unknown" -- overall segment score minue total of all scoreparts -- -- but nothing actually added to Subs table, just subScoreCache -- subScoreCache [ "Subtotal" ] = {} subScoreCache [ "Unknown" ] = {} local gstot = 0 local gunk = 0 for jj = 1, protNfo.segCnt do local stot = 0 local unk = 0 for ii = 1, #Subs do stot = stot + subScoreCache [ Subs [ ii ] ] [ jj ] end subScoreCache [ "Subtotal" ] [ jj ] = stot gstot = gstot + stot unk = segScoreCache [ jj ] - stot subScoreCache [ "Unknown" ] [ jj ] = segScoreCache [ jj ] - stot gunk = gunk + unk end result [ #result + 1 ] = { "Subtotal", gstot, true } result [ #result + 1 ] = { "Unknown", gunk, true } divline () print ( #result .. " active subscores" ) print ( soot ) print ( "total of all subscores: " .. round ( gTotal ) ) print ( "total of all segment scores: " .. round ( gTotalS ) ) if ( round ( gTotal ) ~= round ( gTotalS ) ) then print ( "WARNING: total subscores " .. round ( gTotal ) .. " not equal total segment scores " .. round ( gTotalS ) ) end return result, gTotal, gTotalS end function FindActiveFilters () filter.EnableAll() local fnames = filter.GetNames () print ( #fnames .. " conditions or filters" ) local tbonus = 0 for ii = 1, #fnames do local hasbonus = filter.HasBonus ( fnames [ ii ] ) local fscore = nil if hasbonus then bonus = filter.GetBonus ( fnames [ ii ] ) tbonus = tbonus + bonus else bonus = nil end local satisfied = filter.ConditionSatisfied ( fnames [ ii ] ) local oot = "#" .. ii .. ": " .. fnames [ ii ] .. ", satisfied = " .. tostring ( satisfied ) .. ", has bonus = " .. tostring ( hasbonus ) if hasbonus then oot = oot .. ", bonus = " .. round ( bonus ) end print ( oot ) end print ( "total of individual filter bonuses = " .. round ( tbonus ) ) end -- print segment scores in spreadsheet format -- -- subScores - selected subscores -- nonprot - number of non-protein segments -- locked - number of locked segments -- slocked - number of locked segments -- chains - number of chains -- function SegScores ( subScores, nonprot, locked, slocked, chains ) local tReport = "" local headStr = "seg" .. delim if chains > 1 then headStr = headStr .. "chain" .. delim headStr = headStr .. "residue" .. delim end headStr = headStr .. "ID" .. delim .. "SS" .. delim if nonprot > 0 then headStr = headStr .. "type" .. delim end if kLongnm then headStr = headStr .. "name" .. delim end if kAbbrev then headStr = headStr .. "abbrev" .. delim end if locked > 0 or slocked > 0 then headStr = headStr .. "bb_lock" .. delim headStr = headStr .. "sc_lock" .. delim end if kHydro then headStr = headStr .. "Hyd" .. delim end if kAtom then headStr = headStr .. "atoms" .. delim end if kRotamer then headStr = headStr .. "rotamers" .. delim end headStr = headStr .. "score" .. delim for ii = 1, #subScores do if subScores [ ii ] [ 3 ] then headStr = headStr .. subScores [ ii ] [ 1 ] .. delim end end divline () print ( "\"segment scores\"" ) print ( headStr ) tReport = tReport .. "\"segment scores\"\n" .. headStr .. "\n" local tSegEnergy = 0 for ii = 1, protNfo.segCnt do local segEnergy = segScoreCache [ ii ] tSegEnergy = tSegEnergy + segEnergy local segScore = ii .. delim if chains > 1 then segScore = segScore .. protNfo.chainid [ ii ] .. delim segScore = segScore .. protNfo.chainpos [ ii ] .. delim end segScore = segScore .. protNfo.fastac [ ii ] .. delim .. protNfo.ss [ ii ] .. delim if nonprot > 0 then segScore = segScore .. protNfo.ctype [ ii ] .. delim end if kLongnm then segScore = segScore .. protNfo.long [ ii ] .. delim end if kAbbrev then segScore = segScore .. protNfo.short [ ii ] .. delim end if locked > 0 or slocked > 0 then local ll = "U" if protNfo.lock [ ii ] then ll = "L" end segScore = segScore .. ll .. delim if protNfo.slck [ ii ] then ll = "L" else ll = "U" end segScore = segScore .. ll .. delim end if kHydro then segScore = segScore .. round ( protNfo.hydrop [ ii ] ) .. delim end if kAtom then segScore = segScore .. protNfo.atom [ ii ] .. delim end if kRotamer then segScore = segScore .. protNfo.rot [ ii ] .. delim end segScore = segScore .. round ( segEnergy ) .. delim for jj = 1, #subScores do if subScores [ jj ] [ 3 ] then segScore = segScore .. round ( subScoreCache [ subScores [ jj ] [ 1 ] ] [ ii ] ) .. delim end end print ( segScore ) tReport = tReport .. segScore .. "\n" end local footstr = "totals" .. delim if chains > 1 then footstr = footstr .. delim .. delim -- no totals for chain and segment end footstr = footstr .. "" .. delim .. "" .. delim if nonprot > 0 then footstr = footstr .. delim -- no totals for type end if kLongnm then footstr = footstr .. delim -- no totals for long name end if kAbbrev then footstr = footstr .. delim -- no totals for abbreviation end if locked > 0 or slocked > 0 then footstr = footstr .. delim .. delim -- no totals for backbone, sidechain locked end if kHydro then footstr = footstr .. delim -- no totals for hydropathy end if kAtom then footstr = footstr .. delim -- no totals for atoms end if kRotamer then footstr = footstr .. delim -- no totals for rotamers end footstr = footstr .. round ( tSegEnergy ) .. delim for ii = 1, #subScores do if subScores [ ii ] [ 3 ] then footstr = footstr .. round ( subScores [ ii ] [ 2 ] ) .. delim end end print ( footstr ) tReport = tReport .. footstr .. "\n" return tReport end -- -- print density analysis -- function DensityRat ( ) local tReport = "" local headStr = "\"AA code\"" .. delim .. "\"AA name\"" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim -- -- AA density table - keyed by AA code -- DENCOUNT = 1 DENTOTAL = 2 DENMEAN = 3 DENBEST = 4 DENBESTS = 5 DENWORST = 6 DENWORSTS = 7 -- -- density by amino acid -- local tAA = {} -- -- binary (true/false) tables for density by AA type -- -- -- density of aromatics - true => aromatic -- local tAromatic = {} tAromatic [ true ] = { 0, 0, 0, -999, 0, 999, 0, } tAromatic [ false ] = { 0, 0, 0, -999, 0, 999, 0, } -- -- density of aliphatics - true => alphatic -- local tAliphatic = {} tAliphatic [ true ] = { 0, 0, 0, -999, 0, 999, 0, } tAliphatic [ false ] = { 0, 0, 0, -999, 0, 999, 0, } -- -- density of hydrophobics - true => hydrophobic -- local tHydrophobic = {} tHydrophobic [ true ] = { 0, 0, 0, -999, 0, 999, 0, } tHydrophobic [ false ] = { 0, 0, 0, -999, 0, 999, 0, } -- -- density of helixes - true => helix -- local tHelix = {} tHelix [ true ] = { 0, 0, 0, -999, 0, 999, 0, } tHelix [ false ] = { 0, 0, 0, -999, 0, 999, 0, } -- -- density of sheets - true => sheets -- local tSheet = {} tSheet [ true ] = { 0, 0, 0, -999, 0, 999, 0, } tSheet [ false ] = { 0, 0, 0, -999, 0, 999, 0, } local function denUpdate ( tDen, segDensity, segindx ) tDen [ DENCOUNT ] = tDen [ DENCOUNT ] + 1 tDen [ DENTOTAL ] = tDen [ DENTOTAL ] + math.abs ( segDensity ) if segDensity > tDen [ DENBEST ] then tDen [ DENBEST ] = segDensity tDen [ DENBESTS ] = segindx end if segDensity < tDen [ DENWORST ] then tDen [ DENWORST ] = segDensity tDen [ DENWORSTS ] = segindx end end local tSegDensity = 0 for ii = 1, protNfo.segCnt do local aaCode = protNfo.aa [ ii ] if tAA [ aaCode ] == nil then tAA [ aaCode ] = { 0, 0, 0, -999, 0, 999, 0, } end -- -- update table of density by amino acid -- local segDensity = subScoreCache [ "Density" ] [ ii ] tSegDensity = tSegDensity + math.abs ( segDensity ) local aaDen = tAA [ aaCode ] if aaDen ~= nil then denUpdate ( aaDen, segDensity, ii ) else print ( "ERROR: AA density table entry for " .. aaCode .. " is nil" ) end -- -- update table of density by aromatic vs. non-aromatic -- local aromDen = tAromatic [ Aromatic [ aaCode ] ~= nil ] if aromDen ~= nil then denUpdate ( aromDen, segDensity, ii ) else print ( "ERROR: Aromatic density table entry for " .. aaCode .. " is nil" ) end -- -- update table of density by aliphatic vs. non-aliphatic -- local alipDen = tAliphatic [ Aliphatic [ aaCode ] ~= nil ] if alipDen ~= nil then denUpdate ( alipDen, segDensity, ii ) else print ( "ERROR: Aliphatic density table entry for " .. aaCode .. " is nil" ) end -- -- update table of density by hydrophobic vs. non-hydrophobic -- local phobDen = tHydrophobic [ Hydrophobic [ aaCode ] ~= nil ] if phobDen ~= nil then denUpdate ( phobDen, segDensity, ii ) else print ( "ERROR: hydrophobic density table entry for " .. aaCode .. " is nil" ) end -- -- update table of density by helix -- local helixDen = tHelix [ protNfo.ss [ ii ] == protNfo.HELIX ] if helixDen ~= nil then denUpdate ( helixDen, segDensity, ii ) end -- -- update table of density by sheet -- local sheetDen = tSheet [ protNfo.ss [ ii ] == protNfo.SHEET ] if sheetDen ~= nil then denUpdate ( sheetDen, segDensity, ii ) end end divline () print ( "\"density by AA\"" ) print ( headStr ) tReport = tReport .. "\"density by AA\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tAA ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = aac .. delim .. AminoAcids [ aac ].long .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end local footstr = "totals" .. delim .. protNfo.segCnt .. delim .. round ( tSegDensity ) .. delim .. delim .. round ( tSegDensity / protNfo.segCnt ) print ( footstr ) tReport = tReport .. footstr .. "\n" headStr = "\"aromatic AA\"" .. delim .. "" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim divline () print ( "\"density by aromatic vs. non-aromatic\"" ) print ( headStr ) tReport = tReport .. "\"density by aromatic vs. non-aromatic\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tAromatic ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = tostring ( aac ) .. delim .. "" .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end headStr = "\"aliphatic AA\"" .. delim .. "" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim divline () print ( "\"density by aliphatic vs. non-aliphatic\"" ) print ( headStr ) tReport = tReport .. "\"density by aliphatic vs. non-aliphatic\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tAliphatic ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = tostring ( aac ) .. delim .. "" .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end headStr = "\"hydrophobic AA\"" .. delim .. "" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim divline () print ( "\"density by hydrophobic vs. non-hydrophobic\"" ) print ( headStr ) tReport = tReport .. "\"density by hydrophobic vs. non-hydrophobic\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tHydrophobic ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = tostring ( aac ) .. delim .. "" .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end headStr = "\"helix\"" .. delim .. "" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim divline () print ( "\"density by helix vs. non-helix\"" ) print ( headStr ) tReport = tReport .. "\"density by helix vs. non-helix\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tHelix ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = tostring ( aac ) .. delim .. "" .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end headStr = "\"sheet\"" .. delim .. "" .. delim .. "\"segment count\"" .. delim .. "\"total density\"" .. delim .. "\"% total density\"" .. delim .. "\"mean density\"" .. delim .. "\"worst density\"" .. delim .. "\"worst density seg\"" .. delim .. "\"best density\"" .. delim .. "\"best density seg\"" .. delim divline () print ( "\"density by sheet vs. non-sheet\"" ) print ( headStr ) tReport = tReport .. "\"density by sheet vs. non-sheet\"\n" .. headStr .. "\n" for aac, aaDen in pairs ( tSheet ) do if aaDen [ DENCOUNT ] > 0 then aaDen [ DENMEAN ] = aaDen [ DENTOTAL ] / aaDen [ DENCOUNT ] end local denline = tostring ( aac ) .. delim .. "" .. delim .. aaDen [ DENCOUNT ] .. delim .. round ( aaDen [ DENTOTAL ] ) .. delim .. round ( ( aaDen [ DENTOTAL ] / tSegDensity ) * 100 ) .. delim .. round ( aaDen [ DENMEAN ] ) .. delim .. round ( aaDen [ DENWORST ] ) .. delim .. aaDen [ DENWORSTS ] .. delim .. round ( aaDen [ DENBEST ] ) .. delim .. aaDen [ DENBESTS ] print ( denline ) tReport = tReport .. denline .. "\n" end divline () print ( "\"density deviation (above/below mean density by AA)\"" ) local dendeviate = "" for ii = 1, protNfo.segCnt do local aaCode = protNfo.aa [ ii ] local segDensity = subScoreCache [ "Density" ] [ ii ] local jDenMean = tAA [ aaCode ] [ DENMEAN ] if round ( segDensity ) == round ( jDenMean ) or tAA [ aaCode ] [ DENCOUNT ] == 1 then dendeviate = dendeviate .. "=" elseif segDensity < jDenMean then dendeviate = dendeviate .. "-" else dendeviate = dendeviate .. "+" end end linotype ( dendeviate ) return tReport, dendeviate end -- -- GetStruct -- return a list of structures of a specified type -- -- adapted from spvincent's Helix Rebuild -- function GetStruct ( structT ) local within_struct = false local structList = {} local structStart = 0 local structLast = 0 local structScr = 0 for ii = 1, protNfo.segCnt do if ( protNfo.ss [ ii ] == structT ) then if ( within_struct == false ) then -- start of a new struct within_struct = true structStart = ii structScr = 0 end structLast = ii if ii <= #segScoreCache then structScr = structScr + segScoreCache [ ii ] else structScr = structScr + current.GetSegmentEnergyScore ( ii ) end elseif ( within_struct == true ) then -- end of a struct within_struct = false structList [ #structList + 1 ] = { structT, structStart, structLast, false, structScr } end end if ( within_struct == true ) then structList [ #structList + 1 ] = { structT, structStart, structLast, false, structScr } end return structList end -- -- function to print a little contact table -- function contact ( structs ) local head = delim .. delim local first = true for s = 1, #structs do if structs [ s ] [ STRCTTYP ] == "H" or structs [ s ] [ STRCTTYP ] == "E" then local string = structs [ s ] [ STRCTTYP ] .. delim .. structs [ s ] [ STRCTSTR ] .. delim .. structs [ s ] [ STRCTEND ] for s2 = 1, #structs do if structs [ s2 ] [ STRCTTYP ] == "H" or structs [ s2 ] [ STRCTTYP ] == "E" then if first then head = head .. delim .. structs [ s2 ] [ STRCTTYP ] end local mean = 0 local nb = 0 for i = structs [ s ] [ STRCTSTR ], structs [ s ] [ STRCTEND ] do local min = 999999 for j = structs [ s2 ] [ STRCTSTR ], structs [ s2 ] [ STRCTEND ] do dist = structure.GetDistance ( i, j ) if dist < min then min = dist end end mean = mean + min nb = nb + 1 end mean = mean / nb local c = " " if structure.GetDistance ( structs [ s ] [ STRCTSTR ], structs [ s2 ] [ STRCTEND ] ) < structure.GetDistance ( structs [ s ] [ STRCTSTR ], structs [ s2 ] [ STRCTSTR ] ) then if mean < 5 then c = 'X' elseif mean < 10 then c = 'x' end else if mean < 5 then c = 'O' elseif mean < 10 then c = 'o' end end string = string .. delim .. c end end if first then divline () print ( "\"mini contact table\"" ) print ( head ) first = false end print ( string ) end end end function ShowReport ( tReport, chnz ) local ask = dialog.CreateDialog ( ReVersion .. " copy-and-paste" ) ask.l15 = dialog.AddLabel ( "Click inside the one of the text boxes, then" ) ask.l16 = dialog.AddLabel ( "use ctrl+a (command+a on Mac) to select all," ) ask.l20 = dialog.AddLabel ( "and control+c or command+c to copy, then" ) ask.l30 = dialog.AddLabel ( "paste into spreadsheet" ) ask.l10 = dialog.AddLabel ( "---- segment subscores report ----" ) ask.rep = dialog.AddTextbox ( "subscores:", tReport ) ask.SEQN = dialog.AddLabel ( "---- primary and secondary structure ----" ) for ii = 1, #chnz do local chain = chnz [ ii ] if chain.ctype ~= protNfo.LIGAND then ask [ "chn" .. ii .. "l1" ] = dialog.AddLabel ( "Chain " .. chain.chainid .. " (" .. Ctypes [ chnz [ ii ].ctype ] .. ")" ) ask [ "chn" .. ii .. "l2" ] = dialog.AddLabel ( "segments " .. chain.start .. "-" .. chain.stop .. ", mutables = " .. chain.mute .. ", length = " .. chain.len ) ask [ "chn" .. ii .. "ps" ] = dialog.AddTextbox ( "primary", chain.fasta ) ask [ "chn" .. ii .. "ss" ] = dialog.AddTextbox ( "secondary", chain.ss ) end end ask.OK = dialog.AddButton ( "OK", 1 ) dialog.Show ( ask ) end function ShowDensityReport ( dReport, dendev ) local ask = dialog.CreateDialog ( ReVersion .. " copy-and-paste" ) ask.l15 = dialog.AddLabel ( "Click inside the one of the text boxes, then" ) ask.l16 = dialog.AddLabel ( "use ctrl+a (command+a on Mac) to select all," ) ask.l20 = dialog.AddLabel ( "and control+c or command+c to copy, then" ) ask.l30 = dialog.AddLabel ( "paste into spreadsheet" ) ask.l50 = dialog.AddLabel ( "---- density analysis ----" ) ask.dens = dialog.AddTextbox ( "density:", dReport ) ask.l70 = dialog.AddLabel ( "---- density deviation from mean AA density ----" ) ask.dev = dialog.AddTextbox ( "deviation:", dendev ) ask.OK = dialog.AddButton ( "OK", 1 ) dialog.Show ( ask ) end function GetParms ( scrParts, ligands, chnz ) local ask = dialog.CreateDialog ( ReVersion ) local kRet = 0 repeat if protNfo.segcnt == protNfo.segcnt2 then ask.segcnt = dialog.AddLabel ( protNfo.segCnt2 .. " segments" ) else ask.segcnt = dialog.AddLabel ( protNfo.segCnt .. " segments" ) ask.segcnt2 = dialog.AddLabel ( protNfo.segCnt2 .. " segments, adjusted for ligands" ) end if #chnz > 0 then ask.chnnn = dialog.AddLabel ( #chnz .. " chains" ) for ii = 1, #chnz do local chain = chnz [ ii ] if chain.ctype ~= protNfo.LIGAND then ask [ "chn" .. ii .. "l1" ] = dialog.AddLabel ( "Chain " .. chain.chainid .. " (" .. Ctypes [ chnz [ ii ].ctype ] .. ")" ) ask [ "chn" .. ii .. "l2" ] = dialog.AddLabel ( "segments " .. chain.start .. "-" .. chain.stop .. ", mutables = " .. chain.mute .. ", length = " .. chain.len ) end end end if #ligands > 0 then ask.ligands = dialog.AddLabel ( #ligands .. " ligand section(s), see scriptlog for details" ) end ask.NRGE = dialog.AddLabel ( "---- score information ----" ) --[[ BoxScore = { tSubScores = 0, -- total of active subscores, all segments tSegScores = 0, -- total of segment scores tScoreFilt = 0, -- total score, filters on tScoreFOff = 0, -- total score, filters off tScoreNrgy = 0, -- total energy score tScoreBonus = 0, -- total filter bonus tScoreForm = 0, -- subscores + filter bonus + 8000 tScoreDark = 0, -- total "dark" score } ]]-- ask.active = dialog.AddLabel ( #scrParts .. " active subscores" ) ask.tSubScores = dialog.AddLabel ( "total of all subscores = " .. round ( BoxScore.tSubScores ) ) ask.tScoreFilt = dialog.AddLabel ( "current score = " .. round ( BoxScore.tScoreFilt ) ) if BoxScore.tScoreBonus ~= 0 then ask.tScoreBonus = dialog.AddLabel ( "filter bonus = " .. round ( BoxScore.tScoreBonus ) ) else ask.tScoreBonus = dialog.AddLabel ( "no filter bonus" ) end ask.tScoreForm = dialog.AddLabel ( "subscores + filter bonus + 8000 = " .. round ( BoxScore.tScoreForm ) ) ask.tScoreDark = dialog.AddLabel ( "\"dark\" points = " .. round ( BoxScore.tScoreDark ) ) ask.DETAIL = dialog.AddLabel ( "---- subscore reporting options ----" ) for ii = 1, #scrParts do ask [ scrParts [ ii ] [ 1 ] ] = dialog.AddCheckbox ( scrParts [ ii ] [ 1 ] .. ": " .. round ( scrParts [ ii ] [ 2 ] ) .. " (" .. round ( scrParts [ ii ] [ 2 ] / protNfo.segCnt ) .. " / seg) ", scrParts [ ii ] [ 3 ] ) end ask.SECT = dialog.AddLabel ( "---- report sections ----" ) ask.kContact = dialog.AddCheckbox ( "mini contact table", kContact ) ask.kMutDet = dialog.AddCheckbox ( "mutable details", kMutDet ) if jDensity then ask.kDensity = dialog.AddCheckbox ( "density analysis", kDensity ) end ask.OK = dialog.AddButton ( "OK", 1 ) ask.more = dialog.AddButton ( "More", 2 ) ask.Cancel = dialog.AddButton ( "Cancel", 0 ) kRet = dialog.Show ( ask ) if kRet > 0 then local aPart = 0 for ii = 1, #scrParts do scrParts [ ii ] [ 3 ] = ask [ scrParts [ ii ] [ 1 ] ].value aPart = aPart + 1 end -- -- select all if nothing selected -- if aPart == 0 then for ii = 1, #scrParts do scrParts [ ii ] [ 3 ] = true end end kContact = ask.kContact.value kMutDet = ask.kMutDet.value if jDensity then kDensity = ask.kDensity.value end if kRet == 2 then GetMoreParms () end end until kRet < 2 if kRet == 1 then return true, scrParts end return false, scrParts end function GetMoreParms ( ) local ask = dialog.CreateDialog ( ReVersion ) ask.DETAIL = dialog.AddLabel ( "---- additional columns ----" ) ask.kLongnm = dialog.AddCheckbox ( "long name", kLongnm ) ask.kAbbrev = dialog.AddCheckbox ( "abbreviation", kAbbrev ) ask.kHydro = dialog.AddCheckbox ( "hydropathy index", kHydro ) ask.kAtom = dialog.AddCheckbox ( "atom count", kAtom ) ask.kRotamer = dialog.AddCheckbox ( "rotamer count", kRotamer ) ask.FORMAT = dialog.AddLabel ( "---- formatting options ----" ) ask.jMaxL = dialog.AddSlider ( "line length:", jMaxL, 40, 250, 0 ) ask.kRound = dialog.AddSlider ( "decimal places:", kRound, 1, 8, 0 ) ask.ddlm = dialog.AddLabel ( "delimiters (last selected wins)" ) ask.dtab = dialog.AddCheckbox ( "tab", dtab ) ask.dcomma = dialog.AddCheckbox ( "comma", dcomma ) ask.dsemic = dialog.AddCheckbox ( "semicolon", dsemic ) ask.OK = dialog.AddButton ( "OK", 1 ) ask.Cancel = dialog.AddButton ( "Cancel", 0 ) local kRet = dialog.Show ( ask ) if kRet > 0 then kLongnm = ask.kLongnm.value kAbbrev = ask.kAbbrev.value kHydro = ask.kHydro.value kAtom = ask.kAtom.value kRotamer = ask.kRotamer.value jMaxL = ask.jMaxL.value kRound = ask.kRound.value kFax = 10 ^ -kRound dtab = ask.dtab.value if dtab then delim = "\t" end dcomma = ask.dcomma.value if dcomma then delim = "," end dsemic = ask.dsemic.value if dsemic then delim = ";" end return true end return false end -- -- Ident - print identifying information at beginning and end of recipe -- -- slugline - first line to print - normally recipe name and version -- function Ident ( slugline ) local function round ( ii ) return ii - ii % 0.001 end print ( slugline ) print ( "Puzzle: " .. puzzle.GetName () .. " (" .. puzzle.GetPuzzleID () .. ")" ) print ( "Track: " .. ui.GetTrackName () ) gname = user.GetGroupName () if gname ~= nil then gname = " (" .. gname .. ")" else gname = "" end print ( "User: " .. user.GetPlayerName () .. gname ) local scoretype = scoreboard.GetScoreType () local scort = "" if scoretype == 0 then scort = "soloist" elseif scoretype == 1 then scort = "evolver" elseif scoretype == 2 then scort = "all hands" elseif scoretype == 3 then scort = "no score" else scort = "unknown/error" end print ( "Rank: " .. scoreboard.GetRank ( scoretype ) .. " (" .. scort .. ")" ) local sGroup = scoreboard.GetGroupScore () if sGroup ~= nil then print ( "Group rank / score: " .. scoreboard.GetGroupRank () .. " / " .. round ( 10 * ( 800 - sGroup ) ) ) end end function main () save.Quicksave ( WAYBACK ) divline () Ident ( ReVersion ) -- -- get protein info -- divline () print ( "collecting protein info, please wait" ) protNfo:setNfo () local chainz = protNfo.chains local chw = " chain" if #chainz > 1 then chw = chw .. "s" end print ( #chainz .. chw ) for cc = 1, #chainz do print ( "chain " .. chainz [ cc ].chainid .. ", type = " .. Ctypes [ chainz [ cc ].ctype ] .. ", start = " .. chainz [ cc ].start .. ", end = " .. chainz [ cc ].stop .. ", length = " .. chainz [ cc ].len ) end -- -- determine which subscores are active -- --[[ BoxScore = { tSubScores = 0, -- total of active subscores, all segments tSegScores = 0, -- total of segment scores tScoreFilt = 0, -- total score, filters on tScoreFOff = 0, -- total score, filters off tScoreNrgy = 0, -- total energy score tScoreBonus = 0, -- total filter bonus tScoreForm = 0, -- subscores + filter bonus + 8000 tScoreDark = 0, -- total "dark" score } ]]-- -- -- FindActiveSubscores should be called first, to build subScoreCache -- subScores, BoxScore.tSubScores, BoxScore.tSegScores = FindActiveSubscores () -- -- special check for "Density" subscore -- for ii = 1, #subScores do if subScores [ ii ] [ 1 ] == "Density" then jDensity = true -- density present kDensity = true -- select density report by default break end end -- -- report conditions/filters -- divline () behavior.SetFiltersDisabled ( false ) BoxScore.tScoreFilt = current.GetEnergyScore () behavior.SetFiltersDisabled ( true ) BoxScore.tScoreFOff = current.GetEnergyScore () BoxScore.tScoreBonus = BoxScore.tScoreFilt - BoxScore.tScoreFOff if fBonus ~= 0 then print ( "current filter bonus = " .. round ( BoxScore.tScoreBonus ) ) end behavior.SetFiltersDisabled ( false ) -- -- report on individual filters -- FindActiveFilters () BoxScore.tScoreForm = BoxScore.tSubScores + BoxScore.tScoreBonus + 8000 print ( "subscores + filter bonus + 8000 = " .. round ( BoxScore.tScoreForm ) ) BoxScore.tScoreDark = BoxScore.tScoreFilt - BoxScore.tScoreForm print ( "current score = " .. round ( BoxScore.tScoreFilt ) ) print ( "\"dark\" points = " .. round ( BoxScore.tScoreDark ) ) --[[ the calculation in this Rosetta score logic is correct, but scoreboard.GetScore returns the Rosetta score of the best overall solo or evolver pose, which is not necessarily *this* pose... local sRosetta = scoreboard.GetScore () print ( "Rosetta energy score = " .. round ( sRosetta ) ) local sRosecon = 10 * ( 800 - sRosetta ) print ( "converted Rosetta score = " .. round ( sRosecon ) ) ]]-- -- -- get chains -- local chainz = protNfo.chains -- -- get details for subscore report -- local go, selScores = GetParms ( subScores, protNfo.ligands, chainz ) if go then for cc = 1, #chainz do divline () print ( "chain " .. chainz [ cc ].chainid .. ", type = " .. Ctypes [ chainz [ cc ].ctype ] .. ", start = " .. chainz [ cc ].start .. ", end = " .. chainz [ cc ].stop .. ", length = " .. chainz [ cc ].len ) print ( "" ) if chainz [ cc ].ctype ~= protNfo.LIGAND then -- -- sequence of letters, hydrophobes, structures, locks -- local seq, hydro, struc, types, locks, slocks, locked, slocked = BuildSequence ( chainz [ cc ].start, chainz [ cc ].stop ) -- -- print the sequences -- print ( "primary structure sequence (single-letter amino acid codes for searching PDB)" ) print ( "" ) linotype ( seq, chainz [ cc ].start ) --[[ print ( "type of each segment (P = protein, R = RNA, D = DNA, M = molecule (ligand))" ) linotype ( types ) ]]-- print ( "sequence with i if hydrophobic" ) print ( "" ) linotype ( hydro, chainz [ cc ].start ) print ( "secondary structure" ) print ( "" ) linotype ( struc, chainz [ cc ].start ) if locked > 0 then print ( "locked backbone segments" ) print ( "" ) linotype ( locks, chainz [ cc ].start ) end if slocked > 0 then print ( "locked sidechain segments" ) print ( "" ) linotype ( slocks, chainz [ cc ].start ) end end end -- -- get overall counts for detail report -- TODO: duplicate effort here counting locked and slocked, resolve in next version -- local nonprot = 0 local locked = 0 local slocked = 0 for ll = 1, protNfo.segCnt do if protNfo.ctype [ ll ] ~= protNfo.PROTEIN then nonprot = nonprot + 1 end if protNfo.lock [ ll ] then locked = locked + 1 end if protNfo.slck [ ll ] then slocked = slocked + 1 end end -- -- find modifiable sections -- divline () print ( "modifiable sections - results in Lua table format using segment numbers" ) FindModifiable () -- -- print segment scores -- local tReport = SegScores ( selScores, nonprot, locked, slocked, #chainz ) -- -- print density analysis -- local dReport = nil local dendev = nil if jDensity then dReport, dendev = DensityRat () end if kContact then -- -- detect structures -- local helixList = GetStruct ( "H" ) local sheetList = GetStruct ( "E" ) local structList = {} for ii = 1, #helixList do structList [ #structList + 1 ] = helixList [ ii ] end for ii = 1, #sheetList do structList [ #structList + 1 ] = sheetList [ ii ] end -- -- mini contact table -- contact ( structList ) end -- -- find mutable segments and print them -- if kMutDet then divline () print ( "mutable segments" ) FindMutable ( ) end -- -- show reports for copy and paste -- ShowReport ( tReport, chainz ) if kDensity then ShowDensityReport ( dReport, dendev ) end end -- -- exit via the cleanup function -- cleanup () end function cleanup ( errmsg ) if CLEANUPENTRY ~= nil then return end CLEANUPENTRY = true print ( "---" ) -- -- model 100 - print recipe name, puzzle, track, time, score, and gain -- local reason local start, stop, line, msg if errmsg == nil then reason = "complete" else -- -- model 120 - civilized error reporting, -- thanks to Bruno K. and Jean-Bob -- start, stop, line, msg = errmsg:find ( ":(%d+):%s()" ) if msg ~= nil then errmsg = errmsg:sub ( msg, #errmsg ) end if errmsg:find ( "Cancelled" ) ~= nil then reason = "cancelled" else reason = "error" end end Ident ( ReVersion ) if reason == "error" then print ( "Unexpected error detected" ) print ( "Error line: " .. line ) print ( "Error: \"" .. errmsg .. "\"" ) end save.Quickload ( WAYBACK ) end xpcall ( main, cleanup ) --- end of recipe

Comments


LociOiling Lv 1

Version 2.9 includes detection of chains, which may be helpful in the coronavirus (CoV) puzzles and other complex puzzles.

The recipes AA Edit 2.0 and SS Edit 2.0 also detect chains using similar logic.

In the coronavirus puzzles to date, segments 1 to 117 are the CoV spike protein, which is identified as chain A in the chain-aware recipes. The remaining segments are the designable binder, identified as chain B.

The sequence information is now reported by chain, using letters, A, B, C, and so on.

Foldit still does everything by segment number, so segment 117 is the last segment of chain A in the CoV puzzles, and segment 118 is the first segment of chain B.

In scientific sources, each chain is numbered separately, and the term "residue" is used instead of segment. In the CoV, puzzles, chain A has residues 1-117, then chain B, the binder, starts again at residue 1.

In print protein, a chain may have two sets of "rulers" providing numbering, identifying segment versus residue numbering.

For the first chain, the numbers are the same, so there's just one ruler above the sequence as before. It's now labelled "segment/residue" at the end.

For the second and subsequent chains, the ruler above the starts at 1, and is labelled "residue". Then there's a second ruler underneath the sequence, labelled "segment" giving the Foldit segment number.

For example, the primary sequence of the B chain in puzzle 1811 might look like this:

chain B, type = protein, start = 118, end = 196, length = 79

primary structure sequence (single-letter amino acid codes for searching PDB)

         1         2         3         4         5         6         7        7
1234567890123456789012345678901234567890123456789012345678901234567890123456789  residue 1-79

dqdelkkemderlkewkkkfeelirkgtrqietivdkilhevwdvvyqyvvkddernkedlkkvekllkfvkevydrqk

8901234567890123456789012345678901234567890123456789012345678901234567890123456  segment 118-196
1 2         3         4         5         6         7         8         9     9
1 1         1         1         1         1         1         1         1     1

The primary and secondary structure are now reported by chain, but some of the other reports are still "global", covering all segments at once.

In addition to chain detection, print protein has some new electron density comparisons, as suggested by jeff101 long ago. The density reports now compare helixes versus non-helixes and sheets versus non-sheets. Not all of jeff101's suggested features were implemented, stay tuned on that.

There are also some changes in the main spreadsheet output. For puzzles with more than one chain, the chain id and residue number are reported in new columns.

The "backbone locked" and "sidechain locked" indicators are now two separate columns, where previously they shared one column.

There are also two new columns: "Subtotal", and "Unknown". "Subtotal" reports the total of all subscores for each segment. "Unknown" is the difference between the segment score (current.GetSegmentEnergyScore) and the total of all subscores.

In the CoV puzzle, there are locked segments with a non-zero segment score, but all-zero subscores. The "Unknown" column highlights these segments.

Chains and new columns aside, there are many other minor format changes, intended to make the scriptlog output more user-friendly. There is now a "line length" setting under the "More" button. The line length determines the length of lines printed with a ruler, such as the primary and secondary structure. (Longer lines are also printed without a ruler, for the sake of cut-and-paste.)

There are also a number of internal changes, such as using named members in some internal tables, and converting to method-style function calls in protNfo and other spots.

(edit: corrected what's new in the density reports)

LociOiling Lv 1

Version 2.9 of "print protein" now includes detecting chains. Primary and secondary structure, long with several related items, are now reported separately by chain. Chains have both residue and segment numbering, making for easier comparisons with external sources.

print protein overview

This version of "print protein" is based on the classic "print protein lua2 V0" by marie_s.

The recipe displays detailed scoring information, including the each segment's score and subscores. The subscores include categories like backbone, clashing, packing, hiding, and ideality.

The recipe also reports the protein's primary structure (amino acid sequence) and secondary structure (helixes, sheets, and loops).

The recipe offers copy-and-paste reporting for most of its key outputs. Complete output is also available in the recipe's scriptlog.

Thanks to spvincent, Timo van der Laan, and HerobrinesArmy for code and ideas. Thanks to brgreening for helping to illuminate the mystery of the total score.

protein information

At the start, the recipe gathers all available information from Foldit. This can take a while on large puzzles.

The recipe reports the overall segment count, and gives the details of any ligands found.

The recipe also looks for chains. Most puzzles contain only a single protein chain, but some have multiple chains of proteins or even chains of DNA or RNA. For reporting purposes, each type of chain and also each ligand is listed separately.

scoring information

The recipe detects active subscores using the logic found in "Tvdl enhanced DRW".

In some cases, this logic may suppress certain subscores, such as disulfides, when they have a low total value across all segments. The recipe reports the active subscores in the main dialog and the scriptlog.

The recipe calculates the "filter bonus" by toggling filters off and on, and then checks the total score. In theory, the total score is 8000 points plus the total of all segment subscores, plus the filter bonus. There's is usually a discrepancy, which is reported as "dark" score.

The recipe also reports on each individual filter, including whether it's in the "satisfied" condition, and also whether it awards a bonus, and the actual bonus/penalty if so.

The recipe also reports the Rosetta energy score scoreboard.GetScore, normally a negative number. The recipe converts the Rosetta score to a Foldit score using the formula "FolditScore = 10 * ( 800 - RosettaScore ). Again, there's normally a discrepancy between this converted score and the current score reported by the Foldit client.

sequence information

The recipe reports the primary sequence as a string of single-letter codes, and the secondary structure as a string with "H" for helix, "E" for sheet, "L" for loop, and "M" for molecule, indicating a ligand.

The recipe also uses single-letter codes for RNA or DNA bases.

Complex puzzles may include one or more ligands, multiple protein chains, and even DNA or RNA. Print protein treats each of these items are a separate "chain", reporting its sequence information separately. The recipe assigns chains the identifiers A, B, C, and so on, similar to the scheme found in the PDB.

In the scriptlog, the sequence and secondary structure information is reported both as single strings, and as fixed-length lines with rulers. The single strings are for copy-and-paste into other tools, while the rulers make it easier to find a specific segment. In complex cases, there may be two rulers, with the ruler above giving one-based "residue" numbers, specific to a chain, while the ruler below gives "segment" numbers, which are continuous across all chains.

The recipe also makes the primary sequence and secondary structure are available in a copy-and-paste dialog. Each chain has its own set of copy-and-paste fields.

The recipe issues warning messages to the scriptlog if a non-standard amino acid code or secondary structure code is found. The code "x" is substituted for a non-standard amino acid code. Ligands are represented by code "x".

The recipe also reports hydrophobicity as a string with "i" for if hydrophobic, and "e" if not hydrophobic.

Locked segments are reported as single-character codes - "U" for unlocked, and "L" for locked. There are separate strings for locked backbone and locked sidechains. The same information is also presented in other sections.

modifiable sections

The recipe reports on modifiable sections, including locked and unlocked sections, zero-score sections, and mutable sections. The "mutable segments" report is now optional.

The modifiable sections are reported in Lua table format. Although readable by humans, this table-formatted output can be copied into a recipe if desired. The format compatible with the "segment set and list" module found in TvdL Enhanced DRW and related recipes. Specifically, it uses the "set" format, where each entry in the table gives a starting and ending segment. (Each entry is in itself a table….)

Some puzzles have locked sections with movable sidechains or locked sections that are mutable. Some recipes incorrectly assume that "locked" means not modifiable in any way.

main dialog and segment subscore report

The recipe displays a main dialog before the segment subscore report is produced. Along with reporting other information, the dialog lets you select which subscores are to be included in the report. The mini contact table and detailed mutable reports are also optionally available, as are density analysis reports for Electron Density puzzles.

The main dialog has a "more" button, which displays less frequently used options. The hydropathy index (a fixed value based on the AA code), atom count, and rotamer count can optionally be included, along with the long names and abbreviations for the amino acid or RNA/DNA base. You can select the delimiter character, with the tab character as the default. The number of decimal places reported is also adjustable. The "line length" setting in the "more" dialog controls the maximum length of the sequence information, or anything reported with a ruler.

The segment subscore report available in a cut-and-paste dialog, or in the scriptlog. The report includes a "Subtotal" column, with the total of the subscores for each segment, and an "Unknown" column, showing the difference between the segment's score and the total of its subscores. The subscore report also includes a total line reflecting the column totals for each of the scoring components.

density analysis

For Electron Density puzzles, the recipe offers density analysis, which appears as a default option on puzzles with a density component.

The first section of density analysis looks at density by amino acid type. Some amino acids outscore others. For example, tyrosine might average a density subscore near 50, but glycine might have average density under 20. The "density by AA" section lists each amino acid found in the puzzle, the number of segments with that AA, the total density score of those segments, and the mean density for that AA. It also lists the worst density score and the corresponding segment number, and best density score and segment number.

The next sections are similar, but show the density component for "aromatics" (rings) versus non-aromatics, aliphatics versus non-aliphatics, hydrophobics versus hydrophilics, helix versus non-helix, and sheet versus non-sheet.

Aromatic AAs typically have a much higher density score than non-aromatics. Aliphatics typically score lower than non-aliphatics. Hydrophobics and hydrophilics are close, with hydrophobics typically scoring a bit better.

The aromatics are "f" phenylalanine, "h" histidine, "w" tryptophan, and "y" tyrosine.

For this recipe, aliphatics are "v" valine, "l" leucine, and "i" isoleucine. (Not included: "g" glycine and "a" alanine.)

The first six sections of the density analysis are output in spreadsheet-ready format, similar to the main segment report.

The final section is the "density deviation" report. For each segment, this section shows a "+" if the density subscore is higher than the average for that AA, a "-" if lower, and an "=" if the density subscore is close to the mean.

The density deviation report looks something like this:

"density deviation (above/below mean density by AA)"
1234567890123456789012345678901234567890123456
-++-++-+++-+=+-+---+++=+++++++++++-+----+-=---

The density deviation section is intended to provide a quick indication of which sections are scoring best in terms of density.

The density analysis items are available for copy-and-paste, and can also be retrieved from the scriptlog.

cut-and-paste dialogs

When you click "OK" in the main dialog, the segment subscore report and other selected reports are produced. The cut-and-paste dialog then appears, with text boxes for the subscore report, and the primary and secondary structures of the protein. These fields can be copied and pasted into a spreadsheet or another tool.

LociOiling Lv 1

Version 2.9.1 fixes chain detection when proline is at the N terminal. In this case, the atom count is 18, instead of 15 when proline is mid-chain. Usually the atom count increases by 2 at the N terminal.

(Edit: version 2.9.1, not 2.0.1)

LociOiling Lv 1

Version 2.9.2 fixes a crash when a puzzle has a ligand. It also corrects the code for the DNA base thymine, although this is unlikely to come up in a puzzle. There are also some other slight changes to disulfide bridge detection, but it's still a work in progress.

toshiue Lv 1

I've used your printprotein series on every puzzle for yeaar, love them. Recently (last week or so) line feeds seem to be missing. Importing into spreadsheet not working, must route through Word and add missing line feeds.

LociOiling Lv 1

Version 2.9.3 fixes a problem that cropped up with the monkeypox series, starting with puzzle 2189.

In these puzzles, the binder target lacks an N-terminal and a C-terminal, which breaks the previous chain detection logic.

(N- and C-terminal are detected based on changes in the atom count, as compared to mid-chain residues.)

Version 2.9.3 peeks ahead, and when it sees the next segment is an N-terminal, it makes the current segment a C-terminal.

A similar fix was applied to AA Edit 2.0.2 and SS Edit 2.0.2, which had the same basic problem.

The monkeypox binder target is actually several disjoint pieces of a larger protein, which will be lumped together into one big chain by print protein.

The monkeypox setup is in some ways the opposite of what was seen in the KLHDC2 puzzles. In those puzzles, the target was also pieces of a large protein, but each piece had its own N- and C-terminals. This caused print protein, AA Edit, and SS Edit to see lots of chains. The KLHDC2 puzzles ended before a suitable fix was completed.