Icon representing a recipe

Recipe: AA Edit 2.0.3

created by LociOiling

Profile


Name
AA Edit 2.0.3
ID
108167
Shared with
Public
Parent
AA Edit 2.0.2
Children
Created on
January 08, 2023 at 07:08 AM UTC
Updated on
January 08, 2023 at 07:10 AM UTC
Description

AA Edit displays the protein's amino sequence
using 1-character codes.

For puzzles with "mutable" segments, AA Edit
applies any updates entered to the protein.

Version 2.0 handles multiple chains, and puzzles
with DNA or RNA.

Version 2.0.1 has a quick fix for proline at the
N terminal.

Version 2.0.2 fixes cases where a section of
protein doesn't have the usual N- or C-terminals.
The targets of some binder puzzles don't have
the changes in atom counts which normally mark
the ends of a protein.

Version 2.0.3 handles another case, this time
missing N-terminals where C-terminals are
present. Several Electron Density Reconstruction
puzzles have had this issue.

Best for


Code


--[[ AA Edit - get and set primary structure The primary structure of a protein is the sequence of the amino acids that make up the protein. AA Edit displays the current primary structure as a sequence of single-character amino acid codes. (Similar codes are used for DNA and RNA, see "special cases" below.) The displayed value can be selected and cut or copied. The string of single-character codes is similar to the FASTA format accepted by many protein related tools. FASTA also allows for header information, which some tools, such as BLAST, require. If there are any "mutable" segments, the "Change" button is displayed, and a a new value can be pasted in. If there are no mutable segments, any input to the "seq" box is ignored. When the "Change" button is clicked, the currently displayed primary structure is applied to the protein. The input amino acid codes are converted to lower case. The recipe checks each amino acid code against the list of 20 amino acids used in Foldit. Any input not found in the list is ignored, and the corresponding segment is left unchanged. Some puzzles have a mix of mutable and non-mutable segments. The recipe does not attempt to change any non-mutable segments. If the structure list is longer than the protein, AA Edit discards the extra entries at the end of the list. If the structure list is shorter than the protein, AA Edit applies the list to the first *n* segments of the protein, where *n* is the length of the list. Any remaining segments are unchanged. All changes are written to the scriptlog. special cases ------------- Some puzzles contain two or more separate protein chains. The "insulin mutant" puzzle, which appears periodically as a revisiting puzzle, is an example. AA Edit detects the beginning and end of a protein chain by checking the atom count. Each chain is presented separately, identified by a chain id: "A", "B", "C", and so on. All the normal rules apply to each chain. Some puzzles have one or more ligands, each represented by a segment which returns "x" or "unk" for its amino acid type. This code and anything else not found in the normal list of 20 amino acids is changed to "x" for the purposes of this recipe. Segments with an "x" for their amino acid code in the replacment string are not changed. Each ligand is presented as a separate chain. Very rarely, Foldit puzzles may contain RNA or DNA. These are chains of nucleobases instead of amino acids. Each segment is one nucleobase. Foldit uses two-character codes for RNA and DNA. AA Edit translates these codes into single-character codes. The single-character codes are ambiguous, for example, RNA adenine is code "ra" in Foldit, and DNA adenine is "da". Both become "a" externally, which is also used for alanine in a protein. AA Edit treats each DNA or RNA section as a separate chain. This allows it to keep the ambiguous codes straight. The handling of RNA and DNA has only been tested for RNA. So far, RNA has only appeared on one science puzzle, and the RNA was not mutable in that puzzle. DNA has appeared only in intro puzzles, which don't allow recipes. It's possible that problems may appear if there are ever for-credit DNA or RNA puzzles again. An even rarer case was in found in puzzle 879, segment 134, and puzzle 1378b, segment 30, where an amino acid was modified by a glycan. The code "unk" was used for these modified amino acids, but they did not have the secondary structure code "M" used for ligands. A modified amino acid like this is treated as protein, and does not break the amino acid chain. See "AA Copy Paste Compare v 1.1.1 -- Brow42" for a full-function recipe that works with primary and primary structures. version 1.2 -- 2016/12/23 -- LociOiling * clone of PS Edit v1.2 * enable 1-step undo with undo.SetUndo ( false ) version 2.0 -- 2018/09/02 -- LociOiling * detect and report multiple chains * force filters on at beginning and end * handle DNA and RNA, use single-letter codes externally * refine scriptlog output, eliminate timing calls version 2.0.1 -- 2020/04/16 -- LociOiling * handle proline at N-terminal correctly version 2.0.2 -- 2022/05/20 -- LociOiling * handle cases where structure.GetAminoAcid throws an error * handle lots of little peptides * don't treat ligands as chains * handle a binder target (or similar) with no C-term * fix bug in setChain version 2.0.3 -- 2023/01/08 -- LociOiling * handle missing N terminal this time, a feature of the ED Reconstruction puzzles (kludgistic fix) ]]-- -- -- Globals -- Recipe = "AA Edit" Version = "2.0.3" ReVersion = Recipe .. " " .. Version mutable = false -- true if any mutable segments found AALONG = 1 AACODE = 2 -- redundant for proteins, needed for DNA and RNA AAATOM = 3 AATYPE = 4 -- -- amino acid names and abbeviations, -- third element is mid-chain atom count -- AANames = { a = { "alanine", "a", 10, "P", }, c = { "cysteine", "c", 11, "P", }, d = { "aspartate", "d", 12, "P", }, e = { "glutamate", "e", 15, "P", }, f = { "phenylalanine", "f", 20, "P", }, g = { "glycine", "g", 7, "P", }, h = { "histidine", "h", 17, "P", }, i = { "isoleucine", "i", 19, "P", }, k = { "lysine", "k", 22, "P", }, l = { "leucine", "l", 19, "P", }, m = { "methionine", "m", 17, "P", }, n = { "asparagine", "n", 14, "P", }, p = { "proline", "p", 15, "P", }, q = { "glutamine", "q", 17, "P", }, r = { "arginine", "r", 24, "P", }, s = { "serine", "s", 11, "P", }, t = { "threonine", "t", 14, "P", }, v = { "valine", "v", 16, "P", }, w = { "tryptophan", "w", 24, "P", }, y = { "tyrosine", "y", 21, "P", }, -- -- bonus! codes for ligands ("x" is common, but "unk" is historic) -- x = { "ligand", "x", 0, "M", }, unk = { "ligand", "x", 0, "M", }, -- -- bonus! RNA nucleotides -- ra = { "adenine", "a", 0, "R", }, rc = { "cytosine", "c", 0, "R", }, rg = { "guanine", "g", 0, "R", }, ru = { "uracil", "u", 0, "R", }, -- -- bonus! DNA nucleotides (as seen in PDB, not confirmed for Foldit) -- da = { "adenine", "a", 0, "D", }, dc = { "cytosine", "c", 0, "D", }, dg = { "guanine", "g", 0, "D", }, dt = { "thymine", "t", 0, "D", }, } AA_ATOM_MAX = 27 -- modified AA if over this count -- -- tables for converting external nucleobase codes to Foldit internal codes -- RNAin = { a = "ra", c = "rc", g = "rg", u = "ru", } DNAin = { a = "da", c = "dc", g = "dg", t = "dt", } Ctypes = { P = "protein", D = "DNA", R = "RNA", M = "ligand", } -- -- common section used by all safe functions -- safefun = {} -- -- CommonError -- common routine used by safe functions, -- checks for common errors -- -- checks for errors like bad segment and bad band index -- even for functions where they don't apply -- efficiency -- not a key concern here -- -- any error that appears more than once gets tested here -- -- first return codes may not be unique -- safefun.CommonError = function ( errmsg ) local BADSEG = "segment index out of bounds" local ARGCNT = "Expected %d+ arguments." local BADARG = "bad argument #%d+ to '%?' (%b())" local EXPECT = "expected, got" local BADATOM = "atom number out of bounds" local BADBAND = "band index out of bounds" local BADSYMM = "symmetry index out of bounds" local BADACID = "invalid argument, unknown aa code" local errp, errq = errmsg:find ( BADSEG ) if errp ~= nil then return -1, errmsg end -- -- "bad argument" messages include argument type errors -- and some types of argument value errors -- trap only the argument type errors here -- local errp, errq, errd = errmsg:find ( BADARG ) if errp ~= nil then local errp2 = errd:find ( EXPECT ) if errp2 ~= nil then return -997, errmsg -- argument type error end end local errp, errq = errmsg:find ( ARGCNT ) if errp ~= nil then return -998, errmsg end local errp, errq = errmsg:find ( BADATOM ) if errp ~= nil then return -2, errmsg end local errp, errq = errmsg:find ( BADBAND ) if errp ~= nil then return -3, errmsg end local errp, errq = errmsg:find ( BADACID ) if errp ~= nil then return -2, errmsg end local errp, errq = errmsg:find ( BADSYMM ) if errp ~= nil then return -3, errmsg end return 0, errmsg end -- -- end of common section used by all safe functions -- -- -- structure.SafeGetAminoAcid uses pcall -- to call structure.GetAminoAcid, returning -- a numeric return code. -- -- If the return code is non-zero, -- an error message is also returned. -- -- The return codes are: -- -- 0 - successful, second returned value is -- the one-letter amino acid code -- of the specified segment (string). -- -1 - bad segment index -- -99x - other error -- structure.SafeGetAminoAcid = function ( ... ) local good, errmsg = pcall ( structure.GetAminoAcid, unpack ( arg ) ) if good then return 0, errmsg else local crc, err2 = safefun.CommonError ( errmsg ) if crc ~= 0 then return crc, err2 end return -999, err2 end end function GetAA ( seg ) local good, errmsg = structure.SafeGetAminoAcid ( seg ) if good ~= 0 then errmsg = "unk" end return errmsg end -- -- begin protNfo Beta package version 0.2b -- -- version 0.2a is packaged as a psuedo-class or psuedo-module -- containing a mix of data fields and functions -- -- all entries must be terminated with a comma to keep Lua happy -- -- the commas aren't necessary if only function definitions are present -- -- removed some items found in 0.1 not needed here, -- added N-terminal and C-terminal checks, first and last analysis -- -- this version depends on the external AANames table and associated codes, -- so still a work in progress -- -- version 0.2a contains a quick fix for proline at N-terminal -- version 0.2b contains a quick fix for retroactive N-terminal identification -- -- need to reconcile this version with the more extensive version in print protein -- protNfo = { PROTEIN = "P", LIGAND = "M", RNA = "R", DNA = "D", UNKNOWN_AA = "x", UNKNOWN_BASE = "xx", CYSTEINE_AA = "c", PROLINE_AA = "p", aa = {}, -- amino acid codes ss = {}, -- secondary structure codes atom = {}, -- atom counts mute = {}, -- mutable flag ctype = {}, -- segment type - P, M, R, D first = {}, -- true if segment is first in chain last = {}, -- true if segment is last in chain nterm = {}, -- true if protein and if n-terminal cterm = {}, -- true if protein and if c-terminal fastac = {}, -- external code for FASTA-style output setNfo = function () local segCnt = structure.GetCount () -- -- initial scan: retrieve basic information from Foldit -- local inchain = false for ii = 1, segCnt do local notable = false local ttyp = "" local nterm = false local cterm = false protNfo.aa [ #protNfo.aa + 1 ] = GetAA ( ii ) protNfo.ss [ #protNfo.ss + 1 ] = structure.GetSecondaryStructure ( ii ) protNfo.atom [ #protNfo.atom + 1 ] = structure.GetAtomCount ( ii ) protNfo.mute [ #protNfo.mute + 1 ] = structure.IsMutable ( ii ) local aatab = AANames [ protNfo.aa [ ii ] ] if aatab ~= nil then protNfo.ctype [ #protNfo.ctype + 1 ] = aatab [ AATYPE ] -- -- special case for puzzles 879, 1378b, and similar -- -- if unknown amino acid, but secondary structure is not -- ligand, mark it as protein -- -- segment 134 in puzzle 879 is the example -- if protNfo.ctype [ ii ] == protNfo.LIGAND and protNfo.ss [ ii ] ~= protNfo.LIGAND then protNfo.ctype [ ii ] = protNfo.PROTEIN end else protNfo.ctype [ #protNfo.ctype + 1 ] = protNfo.LIGAND aa = protNfo.UNKNOWN_AA end -- -- for proteins, determine n-terminal and c-terminal -- based on atom count -- if protNfo.ctype [ ii ] == protNfo.PROTEIN then local ac = protNfo.atom [ ii ] -- actual atom count local act = aatab [ AAATOM ] -- reference mid-chain atom count if ac == act and protNfo.aa [ ii ] ~= protNfo.CYSTEINE_AA then -- -- not every puzzle gets the N-terminal atom count right -- try to second-guess the atom count -- if not inchain then ttyp = "N-terminal" nterm = true inchain = true notable = true end elseif ac ~= act or ( protNfo.aa [ ii ] == protNfo.CYSTEINE_AA and ac == act ) then ttyp = "non-standard amino acid" if ac == act + 2 then ttyp = "N-terminal" nterm = true inchain = true notable = true elseif ac == act + 1 then ttyp = "C-terminal" cterm = true notable = true elseif protNfo.aa [ ii ] == protNfo.PROLINE_AA and ac == act + 3 then ttyp = "N-terminal" nterm = true inchain = true notable = true end if protNfo.aa [ ii ] == protNfo.CYSTEINE_AA then local ds = current.GetSegmentEnergySubscore ( ii, "Disulfides" ) -- print ( "cysteine at " .. ii .. ", disulfides score = " .. ds ) if ds ~= 0 and math.abs ( ds ) > 0.01 then nterm = false cterm = false ttyp = "disulfide bridge" if ac == act + 1 then ttyp = "N-terminal" nterm = true inchain = true elseif ac == act then ttyp = "C-terminal" cterm = true end notable = true else ttyp = "unpaired cysteine" notable = false end end end if notable then print ( ttyp .. " detected at segment " .. ii .. ", amino acid = \'" .. protNfo.aa [ ii ] .. "\', atom count = " .. ac .. ", reference count = " .. act .. ", secondary structure = " .. protNfo.ss [ ii ] ) notable = false end end if protNfo.ctype [ ii ] == protNfo.LIGAND then print ( "ligand detected at segment " .. ii ) end protNfo.nterm [ #protNfo.nterm + 1 ] = nterm protNfo.cterm [ #protNfo.cterm + 1 ] = cterm if cterm then inchain = false end protNfo.fastac [ #protNfo.fastac + 1 ] = aatab [ AACODE ] end -- -- rescan to determine first and last in chain for all types -- it's necessary to "peek" at neighbors for DNA and RNA -- for ii = 1, segCnt do local nterm = protNfo.nterm [ ii ] local cterm = protNfo.cterm [ ii ] local first = false local last = false if ii == 1 then first = true end if ii == segCnt then last = true end if protNfo.ctype [ ii ] == protNfo.PROTEIN then if protNfo.nterm [ ii ] then first = true end if protNfo.cterm [ ii ] then last = true end -- -- kludge for cases where binder target doesn't -- have an identifiable C terminal -- if ii < segCnt then if protNfo.ctype [ ii ] == protNfo.PROTEIN or ( protNfo.ctype [ ii ] == protNfo.PROTEIN and protNfo.nterm [ ii + 1 ] ) then last = true end end -- -- special case for puzzles 879, 1378b, and similar -- -- if modified AA ends or begins a chain, mark -- it as C-terminal or N-terminal -- -- hypothetical: no way to test so far! -- if AANames [ protNfo.aa [ ii ] ] [ AACODE ] == protNfo.UNKNOWN_AA then if ii > 1 and protNfo.ctype [ ii - 1 ] ~= protNfo.ctype [ ii ] then first = true protNfo.nterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as N-terminal" ) end if ii < segCnt and protNfo.ctype [ ii + 1 ] ~= protNfo.ctype [ ii ] then last = true protNfo.cterm [ ii ] = true print ( "non-standard amino acid at segment " .. ii .. " marked as C-terminal" ) end end elseif protNfo.ctype [ ii ] == protNfo.DNA or protNfo.ctype [ ii ] == protNfo.RNA then if ii > 1 and protNfo.ctype [ ii - 1 ] ~= protNfo.ctype [ ii ] then first = true end if ii < segCnt and protNfo.ctype [ ii + 1 ] ~= protNfo.ctype [ ii ] then last = true end else -- ligand first = true last = true end protNfo.first [ #protNfo.first + 1 ] = first protNfo.last [ #protNfo.last + 1 ] = last end end, } -- -- end protNfo Beta package version 0.2b -- -- -- end of globals section -- function getChains () -- -- getChains - build a table of the chains found -- -- Most Foldit puzzles contain only a single protein (peptide) chain. -- A few puzzles contain ligands, and some puzzles have had two -- protein chains. Foldit puzzles may also contain RNA or DNA. -- -- For proteins, the atom count can be used to identify the first -- (N terminal) and last (C terminal) ends of the chain. The AANames -- table has the mid-chain atom counts for each amino acid. -- -- Cysteine is a special case, since the presence of a disulfide -- bridge also changes the atom count. -- -- For DNA and RNA, the beginning and end of the chain is determined -- by context at present. For example, if the previous segment was protein -- and this segment is DNA, it's the start of a chain. -- -- Each ligand is treated as a chain of its own, with a length of 1. -- -- chain table entries -- ------------------- -- -- ctype - chain type - "P" for protein, "M" for ligand, "R" for RNA, "D" for DNA -- fasta - FASTA-format sequence, single-letter codes (does not include FASTA header) -- fastab - "backup" of fasta -- start - Foldit segment number of sequence start -- stop - Foldit segment number of sequence end -- len - length of sequence -- chainid - chain id assigned to entry, "A", "B", "C", and so on -- mute - number of mutable segments -- -- For DNA and RNA, fasta and fastab contain single-letter codes, so "a" for adenine. -- The codes overlap the amino acid codes (for example, "a" for alanine). -- The DNA and RNA codes must be converted to the appropriate two-letter codes Foldit -- uses internally, for example "ra" for RNA adenine and "da" for DNA adenine. -- -- -- we're assuming Foldit won't ever have more chains -- local chainid = { "A", "B", "C", "D", "E", "F", "G", "H", "I", "J", "K", "L", "M", "N", "O", "P", "Q", "R", "S", "T", "U", "V", "W", "X", "Y", "Z" } local chainz = {} local chindx = 0 local curchn = nil local segCnt = structure.GetCount () for ii = 1, segCnt do if protNfo.first [ ii ] then chindx = chindx + 1 chainz [ chindx ] = {} curchn = chainz [ chindx ] curchn.ctype = protNfo.ctype [ ii ] curchn.fasta = "" curchn.start = ii curchn.chainid = chainid [ chindx ] curchn.mute = 0 curchn.len = 0 end curchn.fasta = curchn.fasta .. protNfo.fastac [ ii ] if protNfo.mute [ ii ] then curchn.mute = curchn.mute + 1 end if protNfo.last [ ii ] then curchn.stop = ii curchn.len = curchn.stop - ( curchn.start - 1 ) end end for ii = 1, #chainz do chainz [ ii ].fastab = chainz [ ii ].fasta end return chainz end function setChain ( chain ) local changes = 0 local errz = 0 local offset = chain.start - 1 local fastan = "" -- possibly changed chain for ii = 1, chain.stop - ( chain.start - 1 ) do local sType = chain.fasta:sub ( ii, ii ) local oType = chain.fastab:sub ( ii, ii ) -- -- for DNA and RNA, convert FASTA to Foldit -- if chain.ctype == protNfo.DNA then sType = DNAin [ sType ] if sType == nil then sType = protNfo.UNKNOWN_BASE end oType = DNAin [ oType ] if oType == nil then oType = protNfo.UNKNOWN_BASE end elseif chain.ctype == protNfo.RNA then sType = RNAin [ sType ] if sType == nil then sType = protNfo.UNKNOWN_BASE end oType = RNAin [ oType ] if oType == nil then oType = protNfo.UNKNOWN_BASE end end if sType ~= oType then local sName = AANames [ sType ] if sName ~= nil then if protNfo.mute [ ii + offset ] then structure.SetAminoAcid ( ii + offset, sType ) local newaa = structure.GetAminoAcid ( ii + offset ) if newaa == sType then changes = changes + 1 fastan = fastan .. AANames [ sType ] [ AACODE ] else print ( "segment " .. ii + offset .. " (" .. chain.chainid .. ":" .. ii .. ") mutation to type \"" .. sType .. "\" failed" ) errz = errz + 1 fastan = fastan .. AANames [ oType ] [ AACODE ] end else print ( "segment " .. ii + offset .. " (" .. chain.chainid .. ":" .. ii .. ") is not mutable, skipping change to type \"" .. sType .. "\"" ) errz = errz + 1 fastan = fastan .. AANames [ oType ] [ AACODE ] end else print ( "segment " .. ii + offset .. " (" .. chain.chainid .. ":" .. ii .. "), skipping invalid type \"" .. sType .. "\"" ) errz = errz + 1 fastan = fastan .. AANames [ oType ] [ AACODE ] end else fastan = fastan .. AANames [ oType ] [ AACODE ] end end chain.fasta = fastan chain.fastab = fastan return changes, errz end function GetParameters ( chnz, peptides, gchn, minseg, maxseg, totlen, totmut ) local dlog = dialog.CreateDialog ( ReVersion ) dlog.sc0 = dialog.AddLabel ( "segment count = " .. structure.GetCount () ) local cwd = "chain" if #chnz > 1 then cwd = "chains" end dlog.chz = dialog.AddLabel ( #chnz .. " chains" ) for ii = 1, #chnz do local chain = chnz [ ii ] dlog [ "chn" .. ii .. "l1" ] = dialog.AddLabel ( "Chain " .. chain.chainid .. " (" .. Ctypes [ chnz [ ii ].ctype ] .. ")" ) dlog [ "chn" .. ii .. "l2" ] = dialog.AddLabel ( "segments " .. chain.start .. "-" .. chain.stop .. ", mutables = " .. chain.mute .. ", length = " .. chain.len ) dlog [ "chn" .. ii .. "ps" ] = dialog.AddTextbox ( "seq", chain.fasta ) end dlog.u0 = dialog.AddLabel ( "" ) if mutable then dlog.u1 = dialog.AddLabel ( "Usage: click in text box, " ) dlog.u2 = dialog.AddLabel ( "then use select all and copy, cut, or paste" ) dlog.u3 = dialog.AddLabel ( "to save or change primary structure" ) else dlog.u1 = dialog.AddLabel ( "Usage: click in text box," ) dlog.u2 = dialog.AddLabel ( "then use select all and copy" ) dlog.u3 = dialog.AddLabel ( "to save primary structure" ) end dlog.w0 = dialog.AddLabel ( "" ) if mutable then dlog.w1 = dialog.AddLabel ( "Windows: ctrl + a = select all" ) dlog.w2 = dialog.AddLabel ( "Windows: ctrl + x = cut" ) dlog.w3 = dialog.AddLabel ( "Windows: ctrl + c = copy" ) dlog.w4 = dialog.AddLabel ( "Windows: ctrl + v = paste" ) else dlog.w1 = dialog.AddLabel ( "Windows: ctrl + a = select all" ) dlog.w3 = dialog.AddLabel ( "Windows: ctrl + c = copy" ) end dlog.z0 = dialog.AddLabel ( "" ) if mutable then dlog.ok = dialog.AddButton ( "Change" , 1 ) end dlog.exit = dialog.AddButton ( "Exit" , 0 ) if ( dialog.Show ( dlog ) > 0 ) then for ii = 1, #chnz do chnz [ ii ].fasta = ( dlog [ "chn" .. ii .. "ps" ].value:lower ()):sub ( 1, chnz [ ii ].len ) end return true else return false end end function main () print ( ReVersion ) print ( "Puzzle: " .. puzzle.GetName () ) print ( "Track: " .. ui.GetTrackName () ) undo.SetUndo ( false ) protNfo.setNfo () for ii = 1, structure.GetCount () do if protNfo.mute [ ii ] == true then mutable = true break end end local changeNum = 0 local chnTbl = {} -- chains as table of tables chnTbl = getChains () print ( #chnTbl .. " chains and ligands" ) -- -- print the chains and make some tests -- local totlen = 0 local maxlen = 0 local chncnt = 0 local mutchn = 0 local totmut = 0 local gchn = "" local minseg = 99999 local maxseg = 0 for ii = 1, #chnTbl do local chain = chnTbl [ ii ] if chain.stop == nil then chain.stop = 999999 end if chain.ctype ~= "M" then print ( "chain " .. chain.chainid .. ", start = " .. chain.start .. ", end = " .. chain.stop .. ", length = " .. chain.len .. ", mutables = " .. chain.mute ) print ( chain.fasta ) gchn = gchn .. chain.fasta chncnt = chncnt + 1 if chain.mute > 0 then mutchn = mutchn + 1 end if chain.start < minseg then minseg = chain.start end if chain.stop > maxseg then maxseg = chain.stop end totlen = totlen + chain.len if chain.len > maxlen then maxlen = chain.len end else print ( "ligand " .. chain.chainid .. ", segment = " .. chain.start ) end end -- -- assume the worse if average length is under 25 -- local peptides = false local newchn = {} local avglen = totlen / chncnt if avglen < 25 and mutchn == 0 then peptides = true print ( "multiple immutable peptides found" ) print ( "these are likely fragments of a larger protein" ) print ( "combined sequence:" ) print ( gchn ) newchn = { ctype = "P", fasta = gchn, fastab = gchn, start = minseg, stop = maxseg, len = totlen, chainid = "A", mute = totmut, } end if peptides then local mrgchn = {} for ii = 1, #chnTbl do -- TODO: rewrite the table end end while GetParameters ( chnTbl, peptides, gchn, minseg, maxseg, totlen, totmut ) do for ii = 1, #chnTbl do local chain = chnTbl [ ii ] if chain.fasta ~= chain.fastab then print ( "--" ) print ( "chain " .. chain.chainid .. " changed" ) local old = chain.fastab changeNum = changeNum + 1 local start_time = os.time () behavior.SetFiltersDisabled ( true ) local sChg, sErr = setChain ( chnTbl [ ii ] ) behavior.SetFiltersDisabled ( false ) print ( "segments changed = " .. sChg .. ", errors = " .. sErr ) print ( "old chain " .. chain.chainid .. ": " ) print ( old ) print ( "new chain " .. chain.chainid .. ": " ) print ( chain.fastab ) end end end cleanup () end function cleanup ( errmsg ) -- -- do not loop if cleanup causes an error -- if CLEANUPENTRY ~= nil then return end CLEANUPENTRY = true print ( "---" ) local reason local start, stop, line, msg if errmsg == nil then reason = "complete" else start, stop, line, msg = errmsg:find ( ":(%d+):%s()" ) if msg ~= nil then errmsg = errmsg:sub ( msg, #errmsg ) end if errmsg:find ( "Cancelled" ) ~= nil then reason = "cancelled" else reason = "error" end end print ( ReVersion .. " " .. reason ) print ( "Puzzle: " .. puzzle.GetName () ) print ( "Track: " .. ui.GetTrackName () ) if reason == "error" then print ( "Unexpected error detected" ) print ( "Error line: " .. line ) print ( "Error: \"" .. errmsg .. "\"" ) end behavior.SetFiltersDisabled ( false ) end xpcall ( main, cleanup )

Comments


zm0597 Lv 1

EEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSDSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGRK